KEGG   Bacillus subtilis subsp. subtilis 168: BSU00230Help
Entry
BSU00230          CDS       T00010                                 

Gene name
bofA
Definition
(RefSeq) sigma-K factor-processing regulator BofA
  KO
K06317  inhibitor of the pro-sigma K processing machinery
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU00230 (bofA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BofA
Motif
Other DBs
NCBI-GeneID: 937025
NCBI-ProteinID: NP_387904
Pasteur: BG10087
BSORF: BG10087
UniProt: P24282
Position
29772..30035
Genome map
AA seq 87 aa AA seqDB search
MEPIFIIGIILGLVILLFLSGSAAKPLKWIGITAVKFVAGALLLVCVNMFGGSLGIHVPI
NLVTTAISGILGIPGIAALVVIKQFII
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atggagcctatttttattattgggattattttaggactggttattcttctttttttatca
ggttcagcagcgaagcctttaaagtggattggcatcacagctgttaaatttgtggcaggt
gctttgctgctggtttgtgtaaatatgtttggcggcagtcttggcattcatgtgccgatt
aatctggttacaacagctatcagcggaattttaggaatacccggaatagctgcgttagtc
gtcattaagcaatttatcatttaa

DBGET integrated database retrieval system