KEGG   Bacillus subtilis subsp. subtilis 168: BSU00240Help
Entry
BSU00240          CDS       T00010                                 

Gene name
csfB
Definition
(RefSeq) sporulation protein CsfB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gin zf-C3HC4_3 DUF2197
Motif
Other DBs
NCBI-GeneID: 937016
NCBI-ProteinID: NP_387905
Pasteur: BG10088
BSORF: BG10088
UniProt: P37534
Structure
PDB: 

Position
35531..35725
Genome map
AA seq 64 aa AA seqDB search
MDETVKLNHTCVICDQEKNRGIHLYTKFICLDCERKVISTSTSDPDYAFYVKKLKSIHTP
PLYS
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atggacgaaacagttaaacttaatcatacatgtgtgatttgtgatcaagagaagaataga
ggcattcatctttatacgaaattcatatgcttagattgtgagagaaaagtaatttctaca
tcaacttctgatcctgactatgcgttttacgtaaaaaaactaaagagcattcatacaccg
ccattatattcatag

DBGET integrated database retrieval system