KEGG   Bacillus subtilis subsp. subtilis 168: BSU00250Help
Entry
BSU00250          CDS       T00010                                 

Gene name
xpaC
Definition
(RefSeq) 5-bromo 4-chloroindolyl phosphate hydrolysis protein XpaC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Halogen_Hydrol T3SS_needle_E AnfG_VnfG THOC7
Motif
Other DBs
NCBI-GeneID: 937019
NCBI-ProteinID: NP_387906
Pasteur: BG10089
BSORF: BG10089
UniProt: P37467
Position
35845..36459
Genome map
AA seq 204 aa AA seqDB search
MQRFFHFLVWSLTSSATFVFIGILSFFGLNQSIFLSIVYGLASGAAVYIAGIWNARRLFL
KKHELTGREYAYIKKNLEEARQKMVRLRKALFQAKSIQMFKQNAEMLRIVRRIYLLTKKE
PKRFYQAERFFYQTLDSVVELTEKYAFLSSHPKKSKELSMSLSETRITLTELTKRLEEDL
TQAMGDEIDELQFELDAAKHSLKK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcagagattttttcactttttggtgtggagtttaactagcagtgcgacttttgttttc
attggaatattgagcttttttggtttaaaccagtcgatttttttatctattgtttatggg
cttgcttctggagcagccgtatatatagctggcatctggaatgcaagacggttatttctt
aaaaagcatgaattgacaggaagagagtatgcttacattaagaaaaacttagaggaagca
aggcagaaaatggtccgtcttaggaaagccttgtttcaggctaaaagcattcaaatgttt
aagcaaaatgcagaaatgctaaggattgtgagaaggatttatctcctcaccaaaaaagag
ccaaagcggttttatcaggcagaacgatttttttatcaaactctcgattcggttgttgaa
ttgacagagaagtatgcttttctatcatctcacccaaaaaaaagcaaagaactgtcgatg
tcgttaagtgagacacgcatcactcttactgaattgaccaagcgtttagaggaagattta
actcaagcaatgggtgatgaaattgacgagttgcagtttgaattagacgcagcaaaacat
tcattaaagaaataa

DBGET integrated database retrieval system