KEGG   Bacillus subtilis subsp. subtilis 168: BSU00260Help
Entry
BSU00260          CDS       T00010                                 

Gene name
yaaN
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TelA DUF3131 Gar1
Motif
Other DBs
NCBI-GeneID: 936551
NCBI-ProteinID: NP_387907
Pasteur: BG10090
BSORF: BG10090
UniProt: P37535
Position
36478..37638
Genome map
AA seq 386 aa AA seqDB search
MNRDQSDLHIDELLADPFGGNIEIPGSEAVKAEKEQVRLVDVLPEENKEKAIQLAGQIDH
KNMQSIVLYGSQAQSKLLNFSHDMINHVQKKDVGEIGEILGELMKKLEQVNPDDLQSKKK
GFLARMFGRVSSSLQEVLSKYQKTSVQIDRISLKLEHSKNALISDNKLLEQLYEKNKEYF
AALNVYIAAGELKLEELKTKTIPELKQQAESSDHNQMAVQEVNDLIQFADRLDKRVHDLL
LSRQITIQSAPQIRLIQNTNQALAEKIQSSIVTAIPLWKNQVAIALTLLRQRNAVDAQQK
VSDTTNELLLKNAELLKTNTIETARANERGLVDIDTLKKVQESLISTLEETLTIQEEGRI
KRRQAEEELMMMEGDLKQKLITIKER
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgagaccaaagcgaccttcatatagatgaattattggcagatccttttggtggt
aacatagagataccaggttcggaggctgtaaaagcagagaaagagcaagtacggcttgtt
gatgttcttcctgaggaaaacaaggaaaaagcaattcagcttgctggacagattgatcat
aaaaatatgcaaagcattgtcttatacggttcacaagctcaatctaaactgctgaacttt
tctcatgatatgattaatcatgttcaaaagaaggatgtcggggagattggcgaaatactt
ggagagctgatgaaaaagctggagcaagtaaatcctgatgatctccaatctaagaaaaag
ggttttttggcacgcatgtttggaagagtatcaagttctcttcaagaggtgctgtctaaa
taccaaaagaccagtgtgcagatagacagaatcagcttgaagctggagcactctaaaaat
gctttaatcagtgacaacaagctgttagagcagttatatgaaaaaaataaagaatatttc
gcagcgctgaatgtttatattgctgcaggagaactgaagctggaggaattaaaaacaaaa
acgattcctgaactgaagcaacaggctgaatcgagtgatcataaccaaatggccgttcaa
gaggtgaatgatttaattcaatttgctgaccggttagataaaagggtgcatgatttgctg
ctgagcaggcaaattacaatccaaagtgcaccgcaaatcaggctgattcaaaatacaaac
caagcgttagctgaaaagattcagtcatccattgtgacagcgattccgttatggaaaaat
caagttgccattgcactgacgcttttaaggcagcgcaatgcagtggatgcacagcagaaa
gtatctgatacaaccaatgagcttttgctgaaaaatgcggagcttttaaaaaccaataca
attgaaactgcacgggcaaatgaaagaggccttgttgatatagataccttgaagaaggtg
caggaaagcttaataagcacgcttgaagaaacactgactatacaagaagaaggacgaatc
aaacgccgtcaggcagaagaagagctcatgatgatggaaggcgacctgaagcaaaagctg
attacaataaaggaaagatga

DBGET integrated database retrieval system