KEGG   Bacillus subtilis subsp. subtilis 168: BSU00270Help
Entry
BSU00270          CDS       T00010                                 

Gene name
yaaO
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OKR_DC_1 Aminotran_1_2 OKR_DC_1_C Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Beta_elim_lyase SepSecS GDC-P Disulph_isomer
Motif
Other DBs
NCBI-GeneID: 937013
NCBI-ProteinID: NP_387908
Pasteur: BG10091
BSORF: BG10091
UniProt: P37536
Position
37720..39162
Genome map
AA seq 480 aa AA seqDB search
MNTPLYKALIQHARRNSHSFHVPGHHNGDVFFDDAKSIFDPLLTIDVTELAGLDDLHHPS
GVIKEAQELASQLYGSAESFFLVNGTTVGNLAMILSVCEPGDTILVQRNCHKSVFHAVDL
SGAEPVYLAPDVDSAMHVPTHVPLGTIKEALEAYPDAKGLVLTNPTYYGHSADLTEIITE
AHHYGIPVLVDEAHGAHFILGEPFPVSALKMGADIVVQSAHKTLPAMTMGSYLHLNSSCR
INRDRVAEYLNRLQSSSPSYPIMASLDIARAYVQHIIEEQKLSDILQRIETLKQTFDSLT
NAEAVNPANPLIITDPLKLTIRSKRGHSGYTLQSILERANIFTELADENQVLLVLPLGGK
RRINAEIIRSIDEEIEKTPPDQTFVSAEWGVQPVTVLPYPKKVLHSFKKEYVSFEEAAGR
LNAEDIIPYPPGIPMIMAGERITKESVQKLSRLISMKTHVQGNMKIKEKQLLVYIEEEKS
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacctttatataaagcattaattcaacatgcgagaagaaattctcattcattt
catgttccgggacatcacaatggagatgtcttttttgatgacgctaagtcaatattcgat
ccgcttctcaccattgatgtaactgaactggcaggactggatgatctccatcatccttct
ggggtgattaaggaagctcaggagcttgccagtcaattatatggatcggcggaaagtttt
tttctggtaaatggtacgactgtcggaaacttagcgatgattttatctgtttgtgaacct
ggtgatacaattctggttcaaagaaactgtcataaatctgtatttcatgctgttgatttg
tccggtgctgagccggtttatcttgcacctgacgttgattcagcgatgcatgtgcctacg
catgttccgcttggaacaattaaagaggccctggaagcatatccagatgcgaaaggcttg
gtactgaccaatccgacatattacggacatagtgctgatttgactgagatcattactgaa
gcccatcattacgggattcctgttttggtcgatgaagcgcatggcgcacattttatttta
ggtgagccttttccggtctcagctttaaaaatgggggcagatattgttgttcagtcggcc
cacaaaacgttgccagccatgacgatgggttcttatttgcatctcaacagcagctgcagg
attaacagggatcgggtggcagagtatttaaaccgattacaaagcagcagcccgtcttat
ccgattatggcttcgttagatattgcccgcgcttatgtacagcatattatagaagaacaa
aagctttctgacattctgcagcggatagaaacacttaaacaaacgtttgattcacttaca
aatgcagaagctgttaaccctgctaatccactgatcatcacggatccgctaaagctcaca
attcgttcaaaacgcgggcattctggctatacgctgcaaagcattttagagcgtgccaac
atattcactgagcttgctgatgaaaatcaagttctgctcgttctcccattgggaggaaaa
cggagaataaacgctgaaatcattagaagcatcgatgaagagattgagaaaacgcctccg
gatcagacgtttgtttctgcagaatggggtgtgcagcctgttactgtcttgccttatcca
aaaaaggtcttacattcgtttaagaaagaatatgtgagctttgaggaagcagctggccgg
cttaatgcagaagatatcatcccttatcctccgggtatcccgatgattatggcgggagaa
agaataacaaaagaaagtgtgcaaaagctcagccgcttgatcagcatgaaaacgcatgtt
caagggaatatgaaaatcaaagagaaacaactacttgtttatatagaagaggagaaatca
tga

DBGET integrated database retrieval system