KEGG   Bacillus subtilis subsp. subtilis 168: BSU00280Help
Entry
BSU00280          CDS       T00010                                 

Gene name
tmk
Definition
(RefSeq) thymidylate kinase
  KO
K00943  dTMP kinase [EC:2.7.4.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU00280 (tmk)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     BSU00280 (tmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylate_kin AAA_28 dNK AAA_30 AAA_16 AAA_22 AAA_17 AAA_18 ATP_bind_1 PPK2 NTPase_1 KTI12 PRK AAA_23 AAA_29 AAA_5 MobB AAA_33 PIF1 APS_kinase
Motif
Other DBs
NCBI-GeneID: 937018
NCBI-ProteinID: NP_387909
Pasteur: BG10092
BSORF: BG10092
UniProt: P37537
Position
39159..39797
Genome map
AA seq 212 aa AA seqDB search
MSGLFITFEGPEGAGKTTVLQEIKNILTAEGLQVMATREPGGIDIAEQIREVILNENNIL
MDPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSSLAYQGYARGLGIDEVLSIN
EFAIGDMMPHVTVYFSIDPEEGLKRIYANGSREKNRLDLEKLDFHTKVQEGYQELMKRFP
ERFHSVDAGQSKDLVVQDVLKVIDEALKKIQL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtttatttattacattcgaaggtcctgaaggtgcagggaaaacgactgttctg
caggagatcaaaaacatactgacagcagaaggccttcaggttatggcaactcgagagcca
ggcggaatagatattgcagaacaaattagagaggttattctgaatgagaacaatatatta
atggacccaaaaacagaagctctcttatatgcggctgcaagacgccagcatttagttgaa
aaagtaaaacctgctttagaacaggggtttatcgttctttgcgacagattcatagacagt
tctcttgcgtatcaaggatatgcaagagggcttggaattgatgaggttctgtccattaat
gaatttgccattggagatatgatgccccatgtaacggtttatttttcaattgatccggaa
gaaggactgaagcgtatttacgcaaacggctcacgggagaaaaacaggctcgatttagaa
aaactggactttcatacaaaagtacaagaaggttatcaagagctgatgaagcgatttccg
gaaagatttcattcagttgatgccgggcaatccaaagacctcgtcgttcaggatgttcta
aaggtgatcgatgaagcgttgaaaaaaattcaattgtga

DBGET integrated database retrieval system