KEGG   Bacillus subtilis subsp. subtilis 168: BSU00290Help
Entry
BSU00290          CDS       T00010                                 

Gene name
yaaQ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CdAMP_rec DUF1887
Motif
Other DBs
NCBI-GeneID: 938610
NCBI-ProteinID: NP_387910
Pasteur: BG10093
BSORF: BG10093
UniProt: P37538
Structure
PDB: 

Position
39871..40200
Genome map
AA seq 109 aa AA seqDB search
MKLIVAVVQDQDSNRLLKTLTDHNFRVTKLATTGGFLKSGNTTFMIGVEDIRVNKALSLI
KENGQKRDQMIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPVDEFHQF
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgatagtggcagttgtacaagatcaggacagcaacagacttttgaaaacctta
acggatcacaacttcagagtcacaaagcttgcaacgacaggaggatttcttaaatcaggc
aatacaacgtttatgatcggtgtcgaggatatacgcgtcaataaagcgttgagtctcatt
aaagaaaacgggcagaaacgtgatcagatgattgcccctgtatctccaatgggtggaaat
gctgattcctatgtcccttatccagtcgaagttgaagttggcggagcgacagtatttgtc
cttccagtcgatgaatttcatcaattttaa

DBGET integrated database retrieval system