KEGG   Bacillus subtilis subsp. subtilis 168: BSU00300Help
Entry
BSU00300          CDS       T00010                                 

Gene name
yaaR
Definition
(RefSeq) hypothetical protein
  KO
K09770  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU00300 (yaaR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF327 Rab3-GTPase_cat
Motif
Other DBs
NCBI-GeneID: 936756
NCBI-ProteinID: NP_387911
Pasteur: BG10094
BSORF: BG10094
UniProt: P37539
Position
40213..40653
Genome map
AA seq 146 aa AA seqDB search
MKINKDIRTFIDNKQIPSVKTSEITASFKTSMENQSSKMKLDQLTRLLSDIEAFGKRLTK
SRNFKDLARFKGLVKRFVKEAVDSGLSHETSKSFDLYGNSRTLGLVKEIDDKLIQLTEEM
MDQEKPAIDLLERIGEIKGLLINLYT
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattaataaagatatacgtacatttatagataataagcagattccctctgtgaaa
acatctgagatcacagcatcgtttaaaacatcaatggaaaaccaaagcagcaaaatgaag
cttgatcagcttaccaggctgttatctgatatagaagcatttggaaaaaggctaacgaaa
tctcggaattttaaagacttagcgagatttaaaggacttgtgaaacgttttgtcaaagaa
gctgtggacagcggtctttcacatgaaacatcgaaaagctttgacctttacgggaacagc
agaacgctgggacttgtgaaagaaatagatgacaaattgatacagcttacggaagagatg
atggatcaggaaaaaccggcaattgatttgctggagcgtattggcgaaataaaaggttta
ttaattaacctttacacatag

DBGET integrated database retrieval system