KEGG   Bacillus subtilis subsp. subtilis 168: BSU00320Help
Entry
BSU00320          CDS       T00010                                 

Gene name
yaaT
Definition
(RefSeq) stage 0 sporulation protein YaaT
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PSP1
Motif
Other DBs
NCBI-GeneID: 937012
NCBI-ProteinID: NP_387913
Pasteur: BG10096
BSORF: BG10096
UniProt: P37541
Position
41657..42484
Genome map
AA seq 275 aa AA seqDB search
MYNVIGVRFKKAGKIYYFDPNGFHIEHDSCVIVETVRGVEYGQVVIANKQVDEHDVVLPL
RKVIRVADDRDLLIVEENKQEALSAFDICQKKVIEHGLDMKLVDVEFTFDRNKVIFYFTA
DGRVDFRELVKDLASIFKTRIELRQIGVRDEAKMLGGIGPCGRMLCCSTFLGDFEPVSIK
MAKDQNLSLNPTKISGLCGRLMCCLKYENDEYETAKEQLPDIGEMITTANGPAKVVGLNI
LERVLQVELINREKVIEYTWEELLEEGVVSAQTTD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgtacaatgtaattggtgtccgctttaagaaagcgggtaaaatatattattttgatccg
aatggatttcatatagaacatgacagctgcgtaattgtagaaactgtcagaggcgttgag
tacggccaggtcgtaattgcaaataaacaggtggatgagcatgatgtggtgcttcccctt
cgaaaagtgatacgtgtggcagacgatcgcgatcttctcattgtagaagaaaataaacag
gaagcactatcagcatttgatatctgccaaaagaaagtgattgagcatggcttggatatg
aagctggtcgatgttgaattcacgtttgatcgcaataaagtcattttttacttcactgct
gacggccgagtcgactttagagagcttgtaaaggatttggcttctatctttaagacaaga
attgagctgcgccaaatcggagtgagggatgaggcaaaaatgctcggaggaatcggtcct
tgcggaagaatgctttgctgttcaacgtttcttggagattttgaacccgtttccattaaa
atggccaaggatcagaacttgtctttaaatcctacgaagatttcgggtctttgcggacga
ttgatgtgctgtctaaaatatgagaacgatgagtatgagacggcaaaagaacagcttccg
gatataggagaaatgattacgacagcaaacggtcccgcgaaggtcgtcggactaaatatt
ctggaacgggtgcttcaggtggaactgataaaccgtgaaaaagtgatagaatatacttgg
gaagagctcttggaagagggcgtcgtatccgcacaaaccacagattaa

DBGET integrated database retrieval system