KEGG   Bacillus subtilis subsp. subtilis 168: BSU00340Help
Entry
BSU00340          CDS       T00010                                 

Gene name
yabB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_25 Methyltransf_10 Cons_hypoth95 UPF0020 N6_Mtase Methyltransf_31 Methyltransf_18 PrmA MetW Methyltransf_4 DUF43 N6-adenineMlase Eco57I PCMT
Motif
Other DBs
NCBI-GeneID: 937011
NCBI-ProteinID: NP_387915
Pasteur: BG10098
BSORF: BG10098
UniProt: P37543
Position
42917..43660
Genome map
AA seq 247 aa AA seqDB search
MVSLHDDERLDYLLAEDMKIIQSPTVFAFSLDAVLLSKFAYVPIQKGKIVDLCTGNGIVP
LLLSTRSKADILGVEIQERLHDMAVRSVEYNKLDDQIQIIHDDLKNMPEKLGHNRYDVVT
CNPPYFKTPKQTEQNMNEHLRIARHEIHCTLEDVISVSSKLLKQGGKAALVHRPGRLLEI
FELMKAYQIEPKRVQFVYPKQGKEANTILVEGIKGGRPDLKILPPLFVYDEQNEYTKEIR
TILYGDK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtttcattacatgatgatgaaagattagattatttgctggcagaggacatgaaaatc
atacaaagcccaacagtgtttgctttttcgttggacgctgtgcttctgtccaaatttgcg
tacgttccgattcaaaaagggaaaattgttgatttatgcaccggcaatggtattgtgccg
ctgctgctcagtacaagatcaaaagcagacattctgggagtcgaaattcaagaaagactg
catgatatggctgttcgcagcgtggagtataataagttggacgatcagatccagatcata
catgatgacctgaaaaacatgccggagaaacttggacataatcgatatgatgttgtcacc
tgcaatccgccgtattttaaaacgccgaaacaaactgaacaaaacatgaacgagcatctc
cgaatcgcaagacatgaaatccactgcacgctggaggatgtcatttcagtcagcagcaag
ctgctcaagcaagggggaaaagcagctcttgttcaccggccgggaaggcttctggagatt
tttgaactgatgaaggcttatcaaatcgagccgaaacgtgtacaatttgtctatccgaag
caagggaaagaagccaataccattttggttgaaggtatcaaaggcgggcgcccggatttg
aaaattcttcctcccttattcgtatatgatgaacaaaatgaatatacaaaagaaatcagg
accattttatatggagacaaataa

DBGET integrated database retrieval system