KEGG   Bacillus subtilis subsp. subtilis 168: BSU00350Help
Entry
BSU00350          CDS       T00010                                 

Gene name
yazA
Definition
(RefSeq) hypothetical protein
  KO
K07461  putative endonuclease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    BSU00350 (yazA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIY-YIG XS
Motif
Other DBs
NCBI-GeneID: 937002
NCBI-ProteinID: NP_387916
Pasteur: BG12700
BSORF: BG12700
UniProt: O31414
Position
43647..43946
Genome map
AA seq 99 aa AA seqDB search
METNNHFFYVVKCKDNSWYAGYTNDLHKRVKTHNDGKGAKYTKVRRPVELIFAESFSTKR
EAMQAEYYFKKLTRKKKELYIEEKRNSKEAVYVKAPNEL
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggagacaaataaccatttcttctacgtcgtgaaatgtaaggacaatagctggtatgcc
gggtataccaacgatctgcataaacgagtgaaaacgcacaatgatggaaagggcgcaaag
tacacaaaagtaagacgtccggttgaattaatttttgccgagagcttttcaacaaagcgg
gaagctatgcaggcggaatattatttcaaaaaactaactcggaagaaaaaagagctttat
atagaagaaaagcggaacagcaaggaggctgtatatgttaaggcgccaaatgagctttaa

DBGET integrated database retrieval system