KEGG   Bacillus subtilis subsp. subtilis 168: BSU00360Help
Entry
BSU00360          CDS       T00010                                 

Gene name
yabC
Definition
(RefSeq) ribosomal RNA small subunit methyltransferase I
  KO
K07056  16S rRNA (cytidine1402-2'-O)-methyltransferase [EC:2.1.1.198]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU00360 (yabC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.198  16S rRNA (cytidine1402-2'-O)-methyltransferase
     BSU00360 (yabC)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    BSU00360 (yabC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase
Motif
Other DBs
NCBI-GeneID: 937010
NCBI-ProteinID: NP_387917
Pasteur: BG10099
BSORF: BG10099
UniProt: P37544
Position
43921..44799
Genome map
AA seq 292 aa AA seqDB search
MLRRQMSFNGKSDMGILYLVPTPIGNLEDMTFRAIDTLKSVDAIAAEDTRQTKKLCHVYE
IETPLVSYHEHNKESSGHKIIEWLKSGKNIALVSDAGLPTISDPGAEIVKDFTDIGGYVV
PLPGANAALTALIASGIVPQPFFFYGFLNRQKKEKKKELEALKKRQETIIFYEAPHRLKE
TLSAMAEILGDREIAVTRELTKKYEEFIRGTISEVIGWANEDQIRGEFCLVVEGSNNEEV
DEEEQWWETLTAKEHVEHYISKGATSKEAIKKAAVDRNVPKREVYDAYHIKQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgttaaggcgccaaatgagctttaatggaaagtcggacatggggattctttacttggtc
ccaaccccaatcggaaatttagaggatatgacattccgggcgatcgacacgctgaaatca
gtggatgcgattgctgcggaagatacgaggcaaacgaaaaagctttgtcatgtatatgaa
attgaaacaccgctcgtcagctatcacgaacacaataaagaaagcagtgggcacaaaatt
attgaatggctgaaatcgggaaaaaacattgctcttgtcagtgatgccggtctgccgacg
atttctgatcccggagcggaaattgtaaaggattttacggatataggcggttatgttgtt
ccgttgccgggagcaaatgctgcattaacagctcttattgcttcaggtattgtaccgcag
ccttttttcttttacggttttctcaacagacagaaaaaagaaaagaagaaggagcttgaa
gcccttaaaaaacggcaggaaacgatcattttttatgaagcgccccacagattgaaggaa
accttgtcagcgatggcagagatattaggagatcgggaaattgctgtaacacgtgaactc
actaagaaatatgaagagtttatccgaggaaccatatctgaggtcattggatgggcaaac
gaggatcagatacgcggcgagttttgtcttgtcgtagaaggaagtaataatgaagaggta
gatgaggaagaacaatggtgggaaaccctcactgcgaaagaacatgtcgagcattacatt
tcgaaaggcgctacgtctaaagaagctattaaaaaagcagcagtcgatcgcaatgtacca
aagcgtgaagtgtacgatgcttaccatattaagcaataa

DBGET integrated database retrieval system