KEGG   Bacillus subtilis subsp. subtilis 168: BSU00370Help
Entry
BSU00370          CDS       T00010                                 

Gene name
abrB
Definition
(RefSeq) transition state regulatory protein AbrB
  KO
K06284  AbrB family transcriptional regulator, transcriptional pleiotropic regulator of transition state genes
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU00370 (abrB)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BSU00370 (abrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AbrB_C MazE_antitoxin MraZ PA14
Motif
Other DBs
NCBI-GeneID: 937009
NCBI-ProteinID: NP_387918
Pasteur: BG10100
BSORF: BG10100
UniProt: P08874
Structure
PDB: 

Position
complement(44848..45138)
Genome map
AA seq 96 aa AA seqDB search
MFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTG
EVSDDNLKLAGGKLVLSKEGAEQIISEIQNQLQNLK
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgtttatgaaatctactggtattgtacgtaaagttgatgaattaggacgtgtagttatt
cctatcgaactgcgtcgtactcttggaatcgcagaaaaagatgctcttgaaatctatgtt
gatgatgaaaaaatcatccttaaaaaatataaaccaaacatgacttgccaagtaactggt
gaagtttctgatgataaccttaaacttgcaggcggtaaattggttcttagtaaagaaggc
gctgagcaaatcatcagcgaaatccaaaaccagcttcaaaaccttaaataa

DBGET integrated database retrieval system