KEGG   Bacillus subtilis subsp. subtilis 168: BSU00390Help
Entry
BSU00390          CDS       T00010                                 

Gene name
yabD
Definition
(RefSeq) deoxyribonuclease YabD
  KO
K03424  TatD DNase family protein [EC:3.1.21.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU00390 (yabD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     BSU00390 (yabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TatD_DNase DUF2064 Amidohydro_2
Motif
Other DBs
NCBI-GeneID: 936949
NCBI-ProteinID: NP_387920
Pasteur: BG10102
BSORF: BG10102
UniProt: P37545
Position
47706..48473
Genome map
AA seq 255 aa AA seqDB search
MLFDTHAHLNAEQYDTDLEEVIERAKAEKVERIVVVGFDRPTITRAMEMIEEYDFIYAAI
GWHPVDAIDMTEEDLAWIKELSAHEKVVAIGEMGLDYHWDKSPKDIQKEVFRNQIALAKE
VNLPIIIHNRDATEDVVTILKEEGAEAVGGIMHCFTGSAEVARECMKMNFYLSFGGPVTF
KNAKKPKEVVKEIPNDRLLIETDCPFLTPHPFRGKRNEPSYVKYVAEQIAELKEMTFEEI
ASITTENAKRLFRIN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttgacactcacgcgcatttaaatgcagaacaatatgatactgatcttgaagag
gttattgaacgggcaaaagctgaaaaagttgaacgaattgtcgtagttggttttgaccgt
ccgacgattacccgtgcgatggaaatgattgaggaatatgattttatttatgcagccatt
ggctggcaccctgttgacgctattgacatgacagaggaagacttagcgtggattaaagag
ctttctgctcatgagaaagtggtagcgataggggaaatgggactggattatcattgggat
aaatcacctaaagatattcaaaaagaggtgtttagaaatcaaatcgccttagcgaaagag
gtcaatttgcctattatcattcataaccgtgatgcaacggaggatgtcgtgaccattttg
aaagaggaaggcgcagaagctgtgggcggaatcatgcactgctttacaggaagtgcggaa
gtggcaagagaatgcatgaaaatgaatttttatttatcatttgggggaccggtgacattt
aaaaatgcgaagaaaccgaaggaagtagtgaaggaaattcccaatgaccggctgctgatt
gaaacggactgcccgtttctcacaccgcaccctttccgcgggaaaagaaatgagccaagc
tatgtgaaatatgtggcagaacaaatcgccgaattaaaagaaatgacctttgaagagatt
gcttccatcacgactgaaaatgcgaaaagacttttccgtataaactga

DBGET integrated database retrieval system