KEGG   Bacillus subtilis subsp. subtilis 168: BSU00400Help
Entry
BSU00400          CDS       T00010                                 

Gene name
yabE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF348 3D G5 SecD-TM1 YqgF
Motif
Other DBs
NCBI-GeneID: 936891
NCBI-ProteinID: NP_387921
Pasteur: BG10103
BSORF: BG10103
UniProt: P37546
Position
48629..49942
Genome map
AA seq 437 aa AA seqDB search
MGEREGRVDSLLDTLYNLSEEKEAFFITQKMKKLFSVKLSKSKVILVAACLLLAGSGTAY
AAHELTKQSVSVSINGKKKHIRTHANTVGDLLETLDIKTRDEDKITPAKQTKITADMDVV
YEAAKPVKLTINGEEKTLWSTAKTVGALLDEQDVDVKEQDQIDPAIDTDISKDMKINIEP
AFQVTVNDAGKQKKIWTTSTTVADFLKQQKMNIKDEDKIKPALDAKLTKGKADITITRIE
KVTDVVEEKIAFDVKKQEDASLEKGKEKVVQKGKEGKLKKHFEVVKENGKEVSRELVKEE
TAEQSKDKVIAVGTKQSSPKFETVSASGDSKTVVSRSNESTGKVMTVSSTAYTASCSGCS
GHTATGVNLKNNPNAKVIAVDPNVIPLGSKVHVEGYGYAIAADTGSAIKGNKIDVFFPEK
SSAYRWGNKTVKIKILN
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
ttgggagaaagagaagggagggttgacagccttttagatactctatataatctctccgag
gagaaggaggcgtttttcatcacacaaaaaatgaaaaagctgttttccgtaaagcttagc
aaaagcaaagtcattctggttgctgcttgtttgcttttggcaggaagcgggactgcgtac
gcggctcatgagctgacgaaacaatcagtctcagtttctatcaatggcaaaaagaaacat
atacgcacacatgcaaatacagtcggtgatcttttggagacgcttgatataaagacaaga
gacgaagacaagatcacacctgctaaacagacaaagataacagcagacatggacgttgtg
tatgaggctgcaaaacctgtgaagcttacaataaacggggaagaaaagacgttatggtca
acagcaaaaacggtcggtgcattactggacgaacaagatgttgatgtgaaagaacaagat
caaattgatcccgcaatagatacagatatttcgaaagacatgaagattaacatagagccc
gcatttcaggttactgtgaatgatgcagggaaacaaaagaagatctggacgacttcgact
acggtcgctgactttttaaaacagcaaaagatgaacataaaagacgaagataaaatcaag
cctgcgttagatgcaaagctgacgaaaggaaaggctgatattacaattactcgtatcgaa
aaggtcaccgatgtagttgaagagaagattgcgttcgatgtgaaaaagcaagaagacgct
tctcttgaaaaagggaaagaaaaggtcgtccaaaaaggaaaagaaggcaagctaaaaaaa
catttcgaagtcgttaaagaaaacggtaaagaagtgtccagagagcttgtaaaagaagaa
acagctgaacaaagcaaagataaagtgattgctgtcggcacaaagcaaagcagtccaaaa
tttgaaacggtcagtgcttcaggtgattcaaaaacagttgtgtcccgcagcaatgaatca
acaggcaaagtcatgactgtatcatctacggcttatacggcaagctgcagcggttgttca
ggacatacagcgacaggcgtcaatttaaaaaataatccgaatgccaaagtcatcgctgtg
gatccaaatgtcattccgctaggctccaaagtccacgtggaaggctatggatatgccatt
gctgcagataccggttcagcgattaaagggaacaagatagacgtctttttcccagagaaa
tcatcggcgtaccgatggggaaataaaacagtcaaaattaaaatcttaaattag

DBGET integrated database retrieval system