KEGG   Bacillus subtilis subsp. subtilis 168: BSU00410Help
Entry
BSU00410          CDS       T00010                                 

Gene name
rnmV
Definition
(RefSeq) ribonuclease M5
  KO
K05985  ribonuclease M5 [EC:3.1.26.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU00410 (rnmV)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.8  ribonuclease M5
     BSU00410 (rnmV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4093 Toprim_4 Toprim Toprim_2 T5orf172
Motif
Other DBs
NCBI-GeneID: 937001
NCBI-ProteinID: NP_387922
Pasteur: BG10104
BSORF: BG10104
UniProt: P37547
Position
50087..50647
Genome map
AA seq 186 aa AA seqDB search
MKIKEIIVVEGRDDTARIKLAVDADTIETNGSAIDDHVIDQIRLAQKTRGVIILTDPDFP
GEKIRKTISEAVPGCKHAFLPKHLAKPKNKRGIGVEHASVESIRACLENVHEEMEAQPSD
ISAEDLIHAGLIGGPAAKCRRERLGDLLKIGYTNGKQLQKRLQMFQIKKSDFMSALDTVM
REEQNE
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaagagatcattgtggtcgaggggcgtgacgatacggcccgcatcaaattg
gctgttgatgcagacacaattgaaacaaatggttcagccatcgatgatcatgtgattgac
caaatccgtttggcccagaagacgagaggcgtcattattttaacggatccggactttccg
ggagagaagattcgcaaaaccatctcagaggctgtacccggctgtaagcatgcatttttg
ccaaaacatcttgccaaacctaaaaacaagcggggaattggtgtggagcatgcatcggtt
gaaagcattagggcatgtttagaaaatgtgcatgaggagatggaagcgcagccgagtgac
atttcagctgaggatttgattcatgccggactaataggcgggcctgcggccaaatgccgc
cgggaacgactgggtgatctgttgaaaatcggctatacaaatggcaaacagcttcaaaaa
cggctgcaaatgtttcaaattaaaaaaagtgattttatgagtgcgctcgataccgttatg
cgggaggaacagaatgaataa

DBGET integrated database retrieval system