KEGG   Bacillus subtilis subsp. subtilis 168: BSU00430Help
Entry
BSU00430          CDS       T00010                                 

Gene name
yabG
Definition
(RefSeq) sporulation-specific protease YabG
  KO
K06436  spore coat assemly protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU00430 (yabG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_U57 ABC_transp_aux GDE_N_bis
Motif
Other DBs
NCBI-GeneID: 937005
NCBI-ProteinID: NP_387924
Pasteur: BG10106
BSORF: BG10106
UniProt: P37548
Position
51680..52552
Genome map
AA seq 290 aa AA seqDB search
MQFQIGDMVARKSYQMDVLFRIIGIEQTSKGNSIAILHGDEVRLIADSDFSDLVAVKKDE
QMMRKKKDESRMNESLELLRQDYKLLREKQEYYATSQYQHQEHYFHMPGKVLHLDGDEAY
LKKCLNVYKKIGVPVYGIHCHEKKMSASIEVLLDKYRPDILVITGHDAYSKQKGGIDDLN
AYRHSKHFVETVQTARKKIPHLDQLVIFAGACQSHFESLIRAGANFASSPSRVNIHALDP
VYIVAKISFTPFMERINVWEVLRNTLTREKGLGGIETRGVLRIGMPYKSN
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgcaatttcaaataggggatatggtagccagaaaatcctatcagatggatgttttgttt
cgaattataggaatagagcaaacaagcaaaggaaattcaattgccattttgcatggagat
gaagtcaggctgattgctgattcggatttttctgatctggtggcagtgaaaaaggatgag
cagatgatgcggaaaaagaaagatgagagcagaatgaatgagtcgctcgaattgctccgc
caagattataagctgctcagagaaaagcaggagtactatgcgacaagccaatatcagcat
caggagcattatttccatatgccgggcaaagtgcttcatctggatggtgacgaagcatat
ttgaaaaaatgcctgaatgtctataaaaaaattggagtgccggtctatggcatccattgc
catgaaaagaaaatgtctgcttctattgaagtattgctcgacaaatatcgacctgacatc
ctggtgatcacagggcatgatgcgtactcgaagcaaaagggcggtattgatgatttgaat
gcgtacagacattctaagcactttgttgaaacagttcaaacagcccgaaaaaagatccct
cacttagatcagcttgttatttttgcgggggcctgccaatcccattttgaatcactcatc
agagcgggtgcgaattttgcaagttcaccgtcaagagtcaatattcatgcgcttgatccg
gtatatatcgtcgcgaagatcagctttacgccgtttatggaacggattaatgtatgggaa
gtgctccgtaatacgctgacaagagagaaagggcttggaggtattgaaacaagaggagtt
ctgagaattggtatgccttataagtccaattaa

DBGET integrated database retrieval system