KEGG   Bacillus subtilis subsp. subtilis 168: BSU00440Help
Entry
BSU00440          CDS       T00010                                 

Gene name
veg
Definition
(RefSeq) protein Veg
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VEG
Motif
Other DBs
NCBI-GeneID: 936744
NCBI-ProteinID: NP_387925
Pasteur: BG10107
BSORF: BG10107
UniProt: P37466
Position
52763..53023
Genome map
AA seq 86 aa AA seqDB search
MAKTLSDIKRSLDGNLGKRLTLKANGGRRKTIERSGILAETYPSVFVIQLDQDENSFERV
SYSYADILTETVELTFNDDAASSVAF
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagacgttgtccgatattaaaagatcgcttgatgggaatttaggtaaaaggctg
acgttaaaagcaaacggtggccgccgaaaaacgattgagcgttcgggcattttagctgag
acgtacccttctgtttttgtgatacaactagatcaagacgagaactcgtttgaaagagtt
tcatacagttatgctgatattttgactgagactgttgagctgacatttaatgatgacgcc
gcaagctcagtggcattttaa

DBGET integrated database retrieval system