KEGG   Bacillus subtilis subsp. subtilis 168: BSU00450Help
Entry
BSU00450          CDS       T00010                                 

Gene name
sspF
Definition
(RefSeq) small acid-soluble spore protein SspF
  KO
K06423  small acid-soluble spore protein F (minor alpha/beta-type SASP)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU00450 (sspF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SASP
Motif
Other DBs
NCBI-GeneID: 936996
NCBI-ProteinID: NP_387926
Pasteur: BG10108
BSORF: BG10108
UniProt: P37549
Position
53183..53368
Genome map
AA seq 61 aa AA seqDB search
MGRRRGVMSDEFKYELAKDLGFYDTVKNGGWGEIRARDAGNMVKRAIEIAEQQMAQNQNN
R
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
ttgggcagacgtcgtggagttatgtcagatgagtttaaatatgagctggctaaagacctt
ggtttttatgacacagtaaaaaatggaggctggggtgaaattcgggcccgcgatgccggt
aacatggtgaagcgtgctattgaaatcgccgaacagcaaatggctcagaatcagaataac
cgataa

DBGET integrated database retrieval system