KEGG   Bacillus subtilis subsp. subtilis 168: BSU00460Help
Entry
BSU00460          CDS       T00010                                 

Gene name
ipk
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00900  Terpenoid backbone biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
Module
bsu_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSU00460 (ipk)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BSU00460 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 936970
NCBI-ProteinID: NP_387927
Pasteur: BG10109
BSORF: BG10109
UniProt: P37550
Position
53516..54385
Genome map
AA seq 289 aa AA seqDB search
MRILEKAPAKINLSLDVTRKRPDGYHEVEMIMTTIDLADRIELTELAEDEVRVSSHNRFV
PDDQRNLAYQAAKLIKDRYNVKKGVSIMITKVIPVAAGLAGGSSDAAATLRGLNRLWNLN
LSAETLAELGAEIGSDVSFCVYGGTALATGRGEKIKHISTPPHCWVILAKPTIGVSTAEV
YRALKLDGIEHPDVQGMIEAIEEKSFQKMCSRLGNVLESVTLDMHPEVAMIKNQMKRFGA
DAVLMSGSGPTVFGLVQYESKVQRIYNGLRGFCDQVYAVRMIGEQNALD
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattttagaaaaagcgccagctaagatcaatctgtcacttgacgtcacccgaaaa
cgcccggatggctatcatgaagtcgaaatgatcatgacgacaattgatttagctgatcga
attgaattgacggagcttgcagaggatgaagtgagggtttcctcccacaaccgatttgtg
cctgatgaccaaagaaacttagcttatcaggctgccaagctgatcaaggacagatacaac
gtgaaaaagggagtttccatcatgattacgaaggtaattccggtggctgccggtcttgcc
ggcggaagcagtgatgcggcggcgacactcagagggctgaacagactgtggaatttaaat
ctgtccgcggaaacgcttgctgagcttggagcggaaattggctctgacgtttcattttgt
gtctatggcggaactgcattagcaacagggcgcggcgagaaaattaaacatatcagcacg
cctccgcactgctgggtcattttagcgaagccgacaatcggtgtttcaactgctgaagtg
tacagagcgctgaaactggatggtatagagcatcccgatgtacaaggcatgatcgaggcg
atagaagaaaagagttttcagaagatgtgcagccggttaggcaatgtgcttgaatctgtt
acactcgatatgcatcctgaagttgcgatgatcaaaaaccagatgaaacgctttggtgca
gatgccgtgttaatgagcgggagcggcccgacagtgtttggactggttcagtatgagtcg
aaggtgcagagaatttataacgggttaagaggcttctgcgatcaagtttatgcggtgaga
atgatcggcgaacagaacgctcttgattaa

DBGET integrated database retrieval system