KEGG   Bacillus subtilis subsp. subtilis 168: BSU00470Help
Entry
BSU00470          CDS       T00010                                 

Gene name
purR
Definition
(RefSeq) Pur operon repressor
  KO
K09685  purine operon repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU00470 (purR)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BSU00470 (purR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PuR_N Pribosyltran UPRTase
Motif
Other DBs
NCBI-GeneID: 937000
NCBI-ProteinID: NP_387928
Pasteur: BG10110
BSORF: BG10110
UniProt: P37551
Structure
PDB: 

Position
54441..55298
Genome map
AA seq 285 aa AA seqDB search
MKFRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLTIIKQTFEQQGIGTLL
TVPGAAGGVKYIPKMKQAEAEEFVQTLGQSLANPERILPGGYVYLTDILGKPSVLSKVGK
LFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKDNKVTEGSTVSINYVSGSS
NRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDE
RLVDEYMSLLTLSTINMKEKSIEIQNGNFLRFFKDNLLKNGETES
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttcgtcgcagcggcagattggtggacttaacaaattatttgttaacccatccg
cacgagttaataccgctaacctttttctctgagcggtatgaatctgcaaaatcatcgatc
agtgaagatttaacaattattaaacaaacctttgaacagcaggggattggtactttgctt
actgttcccggagctgccggaggcgttaaatatattccgaaaatgaagcaggctgaagct
gaagagtttgtgcagacacttggacagtcgctggcaaatcctgagcgtatccttccgggc
ggttatgtatatttaacggatatcttaggaaagccatctgtactctccaaggtagggaag
ctgtttgcttccgtgtttgcagagcgcgaaattgatgttgtcatgaccgttgccacgaaa
ggcatccctcttgcgtacgcagctgcaagctatttgaatgtgcctgttgtgatcgttcgt
aaagacaataaggtaacagagggctccacagtcagcattaattacgtttcaggctcctca
aaccgcattcaaacaatgtcacttgcgaaaagaagcatgaaaacgggttcaaacgtactc
attattgatgactttatgaaagcaggcggcaccattaatggtatgattaacctgttggat
gagtttaacgcaaatgtggcgggaatcggcgtcttagttgaagccgaaggagtagatgaa
cgtcttgttgacgaatatatgtcacttcttactctttcaaccatcaacatgaaagagaag
tccattgaaattcagaatggcaattttctgcgtttttttaaagacaatcttttaaagaat
ggagagacagaatcatga

DBGET integrated database retrieval system