KEGG   Bacillus subtilis subsp. subtilis 168: BSU00480Help
Entry
BSU00480          CDS       T00010                                 

Gene name
yabJ
Definition
(RefSeq) enamine/imine deaminase
  KO
K09022  2-iminobutanoate/2-iminopropanoate deaminase [EC:3.5.99.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU00480 (yabJ)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.10  2-iminobutanoate/2-iminopropanoate deaminase
     BSU00480 (yabJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_L-PSP Eclosion
Motif
Other DBs
NCBI-GeneID: 936988
NCBI-ProteinID: NP_387929
Pasteur: BG10111
BSORF: BG10111
UniProt: P37552
Structure
PDB: 

Position
55295..55672
Genome map
AA seq 125 aa AA seqDB search
MTKAVHTKHAPAAIGPYSQGIIVNNMFYSSGQIPLTPSGEMVNGDIKEQTHQVFSNLKAV
LEEAGASFETVVKATVFIADMEQFAEVNEVYGQYFDTHKPARSCVEVARLPKDALVEIEV
IALVK
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagcagtccacacaaaacatgccccagcggcaatcgggccttattcacaaggg
attatcgtcaacaatatgttttacagctcaggccaaatccctttgactccttcaggcgaa
atggtgaatggcgatattaaggagcagactcatcaagtattcagcaatttaaaggcggtt
ctggaagaagcgggtgcttcttttgaaacagttgtaaaagcaactgtatttatcgcggat
atggaacagtttgcggaagtaaacgaagtgtacggacaatattttgacactcacaaaccg
gcgagatcttgtgttgaagtcgcgagactcccgaaggatgcgttagtcgagatcgaagtt
attgcactggtgaaataa

DBGET integrated database retrieval system