KEGG   Bacillus subtilis subsp. subtilis 168: BSU00490Help
Entry
BSU00490          CDS       T00010                                 

Gene name
spoVG
Definition
(RefSeq) septation protein SpoVG
  KO
K06412  stage V sporulation protein G
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU00490 (spoVG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoVG
Motif
Other DBs
NCBI-GeneID: 936959
NCBI-ProteinID: NP_387930
Pasteur: BG10112
BSORF: BG10112
UniProt: P28015
Structure
PDB: 

Position
55866..56159
Genome map
AA seq 97 aa AA seqDB search
MEVTDVRLRRVNTDGRMRAIASITLDHEFVVHDIRVIDGNNGLFVAMPSKRTPDGEFRDI
THPINSSTRGKIQDAVLNEYHRLGDTEALEFEEAGAS
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
gtggaagttactgacgtaagattacgccgcgtgaataccgatggtcgcatgagagcgatt
gcatccatcacgctggatcacgaatttgttgtacatgatattcgtgtgattgatggaaac
aatggtcttttcgttgcgatgccgagtaaacgcacccctgatggagagttccgcgatatt
actcatcctattaattcaagcacgcgaggaaagattcaagatgccgtgttaaatgagtat
catcgtctgggtgacactgaagcattagaattcgaagaagctggagcttcttaa

DBGET integrated database retrieval system