KEGG   Bacillus subtilis subsp. subtilis 168: BSU00500Help
Entry
BSU00500          CDS       T00010                                 

Gene name
glmU
Definition
(RefSeq) bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase
  KO
K04042  bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC:2.7.7.23 2.3.1.157]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
bsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSU00500 (glmU)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.157  glucosamine-1-phosphate N-acetyltransferase
     BSU00500 (glmU)
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.23  UDP-N-acetylglucosamine diphosphorylase
     BSU00500 (glmU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep NTP_transferase NTP_transf_3 IspD Hexapep_2 CTP_transf_3 CofC DUF2064 Fucokinase Nop16 Smr GNT-I
Motif
Other DBs
NCBI-GeneID: 936139
NCBI-ProteinID: NP_387931
Pasteur: BG10113
BSORF: BG10113
UniProt: P14192
Position
56352..57722
Genome map
AA seq 456 aa AA seqDB search
MDKRFAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDEALKLSLSKLVTIVGHGAEEV
KKQLGDKSEYALQAKQLGTAHAVKQAQPFLADEKGVTIVICGDTPLLTAETMEQMLKEHT
QREAKATILTAVAEDPTGYGRIIRSENGAVQKIVEHKDASEEERLVTEINTGTYCFDNEA
LFRAIDQVSNDNAQGEYYLPDVIEILKNEGETVAAYQTGNFQETLGVNDRVALSQAEQFM
KERINKRHMQNGVTLIDPMNTYISPDAVIGSDTVIYPGTVIKGEVQIGEDTIIGPHTEIM
NSAIGSRTVIKQSVVNHSKVGNDVNIGPFAHIRPDSVIGNEVKIGNFVEIKKTQFGDRSK
ASHLSYVGDAEVGTDVNLGCGSITVNYDGKNKYLTKIEDGAFIGCNSNLVAPVTVGEGAY
VAAGSTVTEDVPGKALAIARARQVNKDDYVKNIHKK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggataagcggtttgcagttgttttagcggctggacaaggaacgagaatgaaatcgaag
ctttataaagtccttcatccagtttgcggtaagcctatggtagagcacgtcgtggacgaa
gccttaaaattatctttatcaaagcttgtcacgattgtcggacatggtgcggaagaagtg
aaaaagcagcttggtgataaaagcgagtacgcgcttcaagcaaaacagcttggcactgct
catgctgtaaaacaggcacagccatttcttgctgacgaaaaaggcgtcacaattgtcatt
tgcggagatacgccgcttttgacagcagagacgatggaacagatgctgaaagaacataca
caaagagaagcgaaagctacgattttaactgcggttgcagaagatccaactggatacggc
cgcattattcgcagcgaaaacggagcggttcaaaaaatagttgagcataaggacgcctct
gaagaagaacgtcttgtaactgagatcaacaccggtacgtattgttttgacaatgaagcg
ctatttcgggctattgatcaggtgtctaatgataatgcacaaggcgagtattatttgccg
gatgtcatagagattcttaaaaatgaaggcgaaactgttgccgcttaccagactggtaat
ttccaagaaacgctcggagttaatgatagagttgctctttctcaggcagaacaatttatg
aaagagcgcattaataaacggcatatgcaaaatggcgtgacgttgattgacccgatgaat
acgtatatttctcctgacgctgttatcggaagcgatactgtgatttaccctggaactgtg
attaaaggtgaggtgcaaatcggagaagatacgattattggccctcatacggagattatg
aatagtgccattggcagccgtacggttattaaacaatcggtagtcaatcacagtaaagtg
gggaatgatgtaaacataggaccttttgctcacatcagacctgattctgtcatcgggaat
gaagtgaagatcgggaattttgtagaaattaaaaagactcaattcggagaccgaagcaag
gcatctcatctaagctatgtcggcgatgctgaggtaggcactgatgtaaacctgggctgc
ggttcaattactgtcaattatgatggaaagaataagtatttgacaaaaattgaagatggc
gcgtttatcggctgcaattccaacttggttgcccctgtcacagtcggagaaggcgcttat
gtggcggcaggttcaactgttacggaagatgtacctggaaaagcacttgctattgccaga
gcgagacaagtaaataaagacgattatgtgaaaaatattcataaaaaataa

DBGET integrated database retrieval system