KEGG   Bacillus subtilis subsp. subtilis 168: BSU00510Help
Entry
BSU00510          CDS       T00010                                 

Gene name
prs
Definition
(RefSeq) ribose-phosphate pyrophosphokinase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU00510 (prs)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU00510 (prs)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     BSU00510 (prs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Motif
Other DBs
NCBI-GeneID: 936985
NCBI-ProteinID: NP_387932
Pasteur: BG10114
BSORF: BG10114
UniProt: P14193
Structure
PDB: 

Position
57745..58698
Genome map
AA seq 317 aa AA seqDB search
MSNQYGDKNLKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSDGEVQINIEESIRGCDCY
IIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQDRKARSREPITAKLFAN
LLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVPILGEYFEGKNLEDIVIVSPDHGGVT
RARKLADRLKAPIAIIDKRRPRPNVAEVMNIVGNIEGKTAILIDDIIDTAGTITLAANAL
VENGAKEVYACCTHPVLSGPAVERINNSTIKELVVTNSIKLPEEKKIERFKQLSVGPLLA
EAIIRVHEQQSVSYLFS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatcaatacggagataagaatttaaagattttttctttgaattcgaatccagag
cttgcaaaagaaatcgcagatatagttggagttcaattagggaaatgttctgtcacaaga
tttagtgacggggaagtccaaattaatatcgaagaaagtattcgcggatgtgattgttac
atcatccagtctacaagtgaccccgttaacgagcatattatggaactgctgattatggta
gatgcgttaaaacgcgcttctgcaaaaacgattaacattgttattccttattacggttat
gcgcgtcaagacagaaaagcaagatcccgtgagccaatcacagctaaacttttcgctaac
ctgcttgaaacagccggtgcgactcgtgtgattgcacttgacctgcatgcgccgcaaatt
caaggattctttgatataccgattgaccacttaatgggtgttccgattttaggagaatat
tttgaaggcaaaaatcttgaagatatcgtcattgtttcaccagaccatggcggtgtgaca
cgtgcccgcaaactggctgaccgactaaaagcgccaattgcgattatcgataaacgccgt
ccgcgtccaaacgtggcggaagtcatgaatattgtaggtaacatcgaagggaagactgct
atcctcatcgatgacattattgatactgcaggtacgattacacttgctgctaatgcgctc
gttgaaaacggagcgaaagaagtatatgcatgctgtacacaccctgtactatcaggccct
gcggttgaacggattaataattcaacaattaaagagcttgttgtgacaaacagcatcaag
cttcctgaagaaaagaaaattgaacgctttaagcagctttcagtcggaccgcttctggcc
gaagcgattattcgcgttcatgagcagcaatcagtcagctatctgttcagctaa

DBGET integrated database retrieval system