KEGG   Bacillus subtilis subsp. subtilis 168: BSU00530Help
Entry
BSU00530          CDS       T00010                                 

Gene name
pth
Definition
(RefSeq) peptidyl-tRNA hydrolase
  KO
K01056  peptidyl-tRNA hydrolase, PTH1 family [EC:3.1.1.29]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bsu03012]
    BSU00530 (pth)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.29  aminoacyl-tRNA hydrolase
     BSU00530 (pth)
Translation factors [BR:bsu03012]
 Eukaryotic Type
  Release factors
   BSU00530 (pth)
 Prokaryotic Type
   BSU00530 (pth)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pept_tRNA_hydro
Motif
Other DBs
NCBI-GeneID: 936740
NCBI-ProteinID: NP_387934
Pasteur: BG10116
BSORF: BG10116
UniProt: P37470
Position
59504..60070
Genome map
AA seq 188 aa AA seqDB search
MLVIAGLGNPGKNYENTRHNVGFMVIDQLAKEWNIELNQNKFNGLYGTGFVSGKKVLLVK
PLTYMNLSGECLRPLMDYYDVDNEDLTVIYDDLDLPTGKIRLRTKGSAGGHNGIKSLIQH
LGTSEFDRIRIGIGRPVNGMKVVDYVLGSFTKEEAPEIEEAVDKSVKACEASLSKPFLEV
MNEFNAKV
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtgattgccggtctcggaaacccggggaagaactatgaaaatacacggcataat
gtcggatttatggtgatagatcagcttgcaaaggaatggaatatagagctgaatcaaaat
aaatttaacggattatacggaaccggatttgtttccggcaaaaaggttctacttgttaaa
ccgcttacatatatgaatttatcaggagaatgtttgcggcctttaatggactactatgat
gtcgataacgaagatttgacagtcatttacgacgaccttgaccttccgactggcaagatc
cgtttaagaacgaaaggaagcgccggagggcacaatggcatcaaatcactgatccagcat
cttggaacgtccgagtttgaccgtatccgcatcggaatcggccggcctgtaaacggcatg
aaggtcgttgattatgtgttaggctcctttaccaaggaggaggcacctgagatcgaagaa
gcggttgataaatctgtgaaggcttgtgaggcttctttgagtaaaccgtttttagaagtc
atgaacgaatttaacgcaaaggtataa

DBGET integrated database retrieval system