KEGG   Bacillus subtilis subsp. subtilis 168: BSU00540Help
Entry
BSU00540          CDS       T00010                                 

Gene name
yabK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2757 GFA DZR FYVE zf-AD DUF2039 NUC202 zf-RRN7
Motif
Other DBs
NCBI-GeneID: 936978
NCBI-ProteinID: NP_387935
Pasteur: BG10117
BSORF: BG10117
UniProt: P37553
Structure
PDB: 

Position
60130..60360
Genome map
AA seq 76 aa AA seqDB search
MALHYYCRHCGVKVGSLESSMVSTDSLGFQHLTNEERNDMISYKENGDVHVLTICEDCQE
ALDRNPHYHEYHTFIQ
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atggctttgcattattattgtcgtcattgcggagtgaaagtaggcagtctcgaatcttca
atggtatcgacagactcacttggatttcagcacttaacaaatgaggaaagaaacgatatg
atttcttataaagaaaatggagatgtccatgttttgacgatatgtgaagactgccaagag
gcgcttgaccgaaatccgcattaccacgaatatcacacatttattcaataa

DBGET integrated database retrieval system