KEGG   Bacillus subtilis subsp. subtilis 168: BSU00560Help
Entry
BSU00560          CDS       T00010                                 

Gene name
spoVT
Definition
(RefSeq) stage V sporulation protein T
  KO
K04769  AbrB family transcriptional regulator, stage V sporulation protein T
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU00560 (spoVT)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BSU00560 (spoVT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoVT_C MazE_antitoxin PrlF_antitoxin Spore_YhcN_YlaJ
Motif
Other DBs
NCBI-GeneID: 936975
NCBI-ProteinID: NP_387937
Pasteur: BG10119
BSORF: BG10119
UniProt: P37554
Structure
PDB: 

Position
64099..64635
Genome map
AA seq 178 aa AA seqDB search
MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVILKKYSPISELGDFAK
EYADALYDSLGHSVLICDRDVYIAVSGSSKKDYLNKSISEMLERTMDQRSSVLESDAKSV
QLVNGIDEDMNSYTVGPIVANGDPIGAVVIFSKDQTMGEVEHKAVETAAGFLARQMEQ
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaaccggtatcgtacgtcgtattgatgacttaggtcgggtcgtgattcctaaa
gaaattcgaagaactctgagaatcagggaaggcgatccgcttgagatttttgtagatcgt
gacggagaagtgattttgaaaaagtactctccgatcagtgagcttggagactttgcaaag
gagtatgcagacgcgctttacgacagcctcggccattcagtgctgatttgtgatcgtgat
gtatatattgccgtgtccggcagctccaaaaaagattacttaaacaagtcaatcagcgaa
atgctggaaagaacaatggatcagcgcagctccgtgcttgagagtgatgcgaaatcagta
cagcttgtgaatggaattgatgaggacatgaattcttatactgtaggcccaattgtggcg
aacggtgatccgataggtgctgtggtgatcttttcaaaagatcagacaatgggcgaagta
gagcataaagccgttgaaacagcagctggatttttggctcgtcaaatggaacagtag

DBGET integrated database retrieval system