KEGG   Bacillus subtilis subsp. subtilis 168: BSU00570Help
Entry
BSU00570          CDS       T00010                                 

Gene name
yabM
Definition
(RefSeq) hypothetical protein
  KO
K03328  polysaccharide transporter, PST family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU00570 (yabM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt Polysacc_synt_C MurJ MatE
Motif
Other DBs
NCBI-GeneID: 936539
NCBI-ProteinID: NP_387938
Pasteur: BG10120
BSORF: BG10120
UniProt: P37555
Position
64817..66415
Genome map
AA seq 532 aa AA seqDB search
MDDSIGVKRHWIWQGAFVLILAGVITKILSAVYRVPFQNIVGDVGFYIYQQVYPFLGIAV
MLSTSGFPVIISKLMNDYSEKNHHTILKISALFLSLIGILLFLCLYLGAVPIALFMGDSH
LAVLIQVAAYAFLLFPFVALLRGGFQGRHEMLPSALSQMTEQFLRVAVLLGLSFWLVKKG
ASLYTAGAAAASGSLAGSLVALIILGFFWFKTKRDNQTDRQNENVITTKELTKKLLLYSV
TICVSSLLLLFIQLVDALNLYALLSGGEASEEAKCLKGIYDRGQPLLQLGSVFAVSIATS
LVPYISMAVKNKELKIMKEKITSSLKLCLVLGTGASAGLICILKPVNIMLFQNGEGTGAL
QVFSCSILFASLAVTAAAVLQGAGYTVFPAIAVGAGVAVKWVLNTLLVPRYGIEGASLAT
AASFAAVAGLNLYQLRQKEWLDKLRGVLIPIIGSALLMSAVLLAYTRLWTFLFPATGRGA
AVIESLSAVAIGGAVFIYCMMRLGIFTDEELNSVPFGSKLSKFMRRREQNGG
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggacgattcaataggcgttaaacggcattggatttggcagggggcttttgttttaatt
ctggcaggcgtcatcacaaaaattttaagcgctgtttacagagtcccgtttcaaaacatt
gtcggcgatgttggattttatatatatcagcaggtatacccctttcttggtattgcggtc
atgctgtccacatcaggatttccagtcattatttcaaagctgatgaatgattatagtgaa
aaaaatcatcacaccatattaaaaatatcagcgttgtttttgtctttaatcggtatttta
ttatttctttgtttatatctgggtgctgttcctattgcactctttatgggagattcgcat
ctagccgtgttaattcaagtggccgcatacgcgtttctgcttttcccatttgtcgcgttg
ctaagaggcggttttcaggggcggcacgaaatgctcccttcagccttatcacagatgaca
gagcagtttctgcgtgttgcggtgctcttgggtttatcattttggctcgtgaaaaaggga
gcctcgctttatactgcgggagcggcagccgcttcaggctctcttgccggaagtttggtt
gcattgataatactggggtttttttggttcaaaacgaaaagagacaaccaaacggatagg
caaaacgaaaatgtcatcacaacaaaagaattgacgaaaaaactgcttttatattcggtc
acaatttgtgtaagcagtttgctgcttttgtttatccagcttgttgatgctttgaattta
tatgcattgctttcgggtggtgaggcaagcgaagaagcaaaatgcctaaaggggatctat
gatcggggacaacccttgttgcagctcggttcagtttttgccgtaagcattgcgacgtca
ctcgttccgtatatttctatggctgtaaaaaacaaagagctgaagatcatgaaagaaaaa
atcacgtcatctttgaaactatgccttgtgctcggtacaggcgcatcggctgggttgatt
tgcattctaaagccggtaaatatcatgctgtttcaaaatggagaagggacaggtgcgtta
caagtatttagctgctccattttgtttgcatccttggcggtaacggcagcggcagtctta
cagggagcgggatacacagtttttcctgcgatagcggtgggcgcgggtgttgcggtgaaa
tgggtgttaaacacacttttggttccgcgctatgggattgaaggcgcatcgcttgcgaca
gcggcttcctttgcggctgtcgccggccttaacttgtatcagcttcggcaaaaggaatgg
ctcgataagcttagaggcgttttgattccgattattggatctgctcttttgatgtcagct
gttttgcttgcgtatacgcgtctctggactttcttgtttcctgcaacaggaagaggagcg
gctgtgattgagagtctttctgctgttgccattggtggcgcggtgtttatttattgtatg
atgagattgggaatatttacagatgaagagctgaacagtgtgccattcggcagcaagtta
agcaaattcatgagaaggagagaacaaaatggcgggtaa

DBGET integrated database retrieval system