KEGG   Bacillus subtilis subsp. subtilis 168: BSU00580Help
Entry
BSU00580          CDS       T00010                                 

Gene name
yabN
Definition
(RefSeq) hypothetical protein
  KO
K02499  tetrapyrrole methylase family protein / MazG family protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU00580 (yabN)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BSU00580 (yabN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MazG TP_methylase PRA-PH
Motif
Other DBs
NCBI-GeneID: 936973
NCBI-ProteinID: NP_387939
Pasteur: BG10121
BSORF: BG10121
UniProt: P37556
Position
66405..67874
Genome map
AA seq 489 aa AA seqDB search
MAGKITVVGLGAGDMDQLTIGIHKLLTKADTLYVRTKDHPLIEELEKETKNIRFFDDIYE
KHDQFEAVYEEIADILFEAARREDVVYAVPGHPFVAEKTVQLLTERQEKENVQVKVAGGQ
SFLDATFNVLQIDPIEGFQFVDAGTLSADELELRHHLIICQVYDQMTASEVKLTLMEKLP
DDYEVVIVTAAGSRGEEIRTVPLFELDRNVALNNLTSVYIPPIKEEKLLYHEFSTFRSII
RELRGPNGCPWDKKQTHQSLKQYMIEECYELLEAIDEEDTDHMIEELGDVLLQVLLHAQI
GEDEGYFTIDDVIKGISEKMVRRHPHVFKDVKVQDENDVLANWEDIKKAEKNTSESSLLD
SVPKTLPALSKAAKLQKKAAKVGFDWEDVSDIWEKVSEEMKEFSSEVSEAPHEHNLKAEF
GDILFALVNVARFYKIEPEEALTMTNDKFRRRFSYIEETAKEEGVELADMSLEDMDKLWN
EAKETERRS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtaaaattacagtcgtcggacttggtgccggagacatggaccaattgacaatt
ggtatacacaagctgctgacgaaggcagatacgctgtatgtcagaaccaaggatcatcct
ttaattgaggagcttgaaaaagaaacgaagaacatccgtttctttgatgatatatatgag
aaacatgatcagttcgaggcggtatatgaagaaattgcagatatcctctttgaagcggcg
cggcgtgaggacgtggtttacgctgtgccgggacacccttttgtcgcagaaaaaacagtt
cagctgctgacggagcggcaggaaaaggaaaacgttcaagtgaaagtcgcggggggacaa
agtttccttgatgccacattcaatgtcttgcaaattgacccgattgaaggttttcaattt
gtggatgccggcacattgtccgcggatgagcttgagctcagacatcatctgatcatatgt
caggtttacgaccaaatgacggcttctgaagtcaagctgacattgatggagaagctgcct
gatgattatgaggtcgtcattgtgactgcagcaggcagccgtggcgaggagatcaggaca
gtgccattatttgagctggaccgcaatgtcgctttgaacaacttaacaagtgtgtatatt
ccgccgattaaagaagagaagctgctttatcacgaattctccacgttccgaagcatcatc
agagagcttcgcggacctaatggatgtccgtgggataaaaagcagacgcatcagtcatta
aagcagtacatgattgaagaatgttatgagcttctcgaagctattgacgaagaagacaca
gaccatatgatcgaagagcttggcgacgttttgcttcaggtcttgcttcacgcgcaaatt
ggtgaagatgaaggttatttcacaattgatgatgtcataaaaggaatcagtgaaaaaatg
gtccgaagacatccccatgtgtttaaagatgttaaggttcaggatgaaaacgatgtttta
gccaattgggaagatataaaaaaggccgaaaaaaatacatctgaatcatcattactagac
agcgtaccgaaaacccttccagctctttcgaaagcagctaaattgcagaaaaaagcagcg
aaggtcggttttgactgggaagacgtcagcgatatttgggaaaaggtaagtgaggaaatg
aaggaattttcttctgaggtttctgaagctcctcacgaacacaatcttaaagctgagttt
ggcgacattttgttcgcgctggtgaatgtagcccgcttctacaaaatagagccagaggaa
gcgctgaccatgactaatgacaaattccggagacggttctcgtacattgaggaaacagcg
aaggaagagggagtcgagttggctgatatgtcccttgaggacatggacaaactgtggaat
gaagcaaaagaaactgagaggagatcatag

DBGET integrated database retrieval system