KEGG   Bacillus subtilis subsp. subtilis 168: BSU00590Help
Entry
BSU00590          CDS       T00010                                 

Gene name
yabO
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S4 S4_2
Motif
Other DBs
NCBI-GeneID: 936800
NCBI-ProteinID: NP_387940
Pasteur: BG10122
BSORF: BG10122
UniProt: P37557
Position
67877..68137
Genome map
AA seq 86 aa AA seqDB search
MRLDKFLKVSRLIKRRTLAKEVADQGRISINGNQAKASSDVKPGDELTVRFGQKLVTVQV
NELKDTTKKEEAANMYTILKEEKLGE
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgagattagataaatttttgaaagtatcacggctgatcaaacggcgtacactagcgaag
gaagtagctgaccaaggacgaatctctattaacggaaaccaagctaaagctagctctgac
gtaaaaccgggagatgaactaacggtccgcttcggccaaaagcttgtaacggttcaagtt
aatgaattgaaagacacgacgaaaaaagaagaagctgcaaacatgtacacgattctaaaa
gaagaaaaactcggcgaatag

DBGET integrated database retrieval system