KEGG   Bacillus subtilis subsp. subtilis 168: BSU00600Help
Entry
BSU00600          CDS       T00010                                 

Gene name
yabP
Definition
(RefSeq) spore protein YabP
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YabP
Motif
Other DBs
NCBI-GeneID: 936966
NCBI-ProteinID: NP_387941
Pasteur: BG10123
BSORF: BG10123
UniProt: P37558
Position
68216..68518
Genome map
AA seq 100 aa AA seqDB search
MNSYYDQKGSSSVPEQHDVTMKGRKHLDISGVKHVESFDNEEFLLETVMGMLSVRGQNLQ
MKNLDVEKGIVSIKGRVFDLVYLDEQQGDKAKGFFSKLFK
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgaattcatattatgatcaaaaaggttcttcgtctgttccggaacagcatgatgtgaca
atgaaaggccggaagcatttagatatttctggggttaagcatgtggagagttttgataac
gaagaattcctgctggaaacggtgatgggaatgctctccgtcagaggccaaaacctgcag
atgaaaaatcttgatgtggaaaaagggattgtttcgattaaaggcagggtatttgattta
gtgtacttagacgaacaacaaggggataaagctaaagggttttttagcaagttgtttaaa
tga

DBGET integrated database retrieval system