KEGG   Bacillus subtilis subsp. subtilis 168: BSU00610Help
Entry
BSU00610          CDS       T00010                                 

Gene name
yabQ
Definition
(RefSeq) spore protein YabQ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_YabQ
Motif
Other DBs
NCBI-GeneID: 936971
NCBI-ProteinID: NP_387942
Pasteur: BG10124
BSORF: BG10124
UniProt: P37559
Position
68515..69150
Genome map
AA seq 211 aa AA seqDB search
MTLTTQFYTMLAMSGMGLWLGASLDTYRLFVIRAKTARWLLFIHDILFWIMQGLLFFYVL
LHVNEGEFRIYIFLAVLLGVATYQSLCKRIYIKILKFVIYLVVSVYQFFKKLIQHVLFRP
IVWTCGAIIWLAAFLFKKTYSLIGFLLLCLYKIVMVLCFPIRFIAKQCLKLLPVKMRLTF
RRYFEKGAGFLKKKKKLLITIRTTITRFLKR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgacgacacaattctatacaatgctagcgatgtccggtatgggtctctggctt
ggtgcttcgcttgatacataccggctctttgtcattcgtgccaaaacagccagatggcta
ttatttattcatgatattcttttctggattatgcaagggctgcttttcttttatgtcttg
cttcatgtaaatgagggagaattcaggatttacatctttttagcggttctgctgggcgtt
gcgacgtatcagagcctttgcaaacgaatctatataaaaatactgaaattcgtcatttac
cttgttgtttctgtttatcaattcttcaaaaaactcattcagcacgtgttatttcgtcct
attgtgtggacatgcggagcgatcatctggctggcggcatttttattcaagaaaacatac
agcctgataggttttctcctgctgtgtctatataaaatagtcatggttctgtgttttccg
atccgttttatcgcgaaacaatgtttgaaacttcttcctgtgaaaatgcgtctaactttt
agacgttattttgaaaaaggtgcaggatttctcaaaaagaagaagaaactattgataacc
ataagaacgaccatcacacggtttttgaagagatga

DBGET integrated database retrieval system