KEGG   Bacillus subtilis subsp. subtilis 168: BSU00620Help
Entry
BSU00620          CDS       T00010                                 

Gene name
divIC
Definition
(RefSeq) cell division protein DivIC
  KO
K13052  cell division protein DivIC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU00620 (divIC)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BSU00620 (divIC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DivIC MHC2-interact bZIP_1 V_ATPase_I Prefoldin_2 Flagellin_C OAD_gamma CCDC-167 DUF2157 FTCD_C Ureide_permease LapA_dom FtsL DUF3328 Peptidase_M56 MAP17 DUF5320 ADIP ZapB
Motif
Other DBs
NCBI-GeneID: 936786
NCBI-ProteinID: NP_387943
Pasteur: BG10125
BSORF: BG10125
UniProt: P37471
Position
69168..69545
Genome map
AA seq 125 aa AA seqDB search
MNFSRERTITEIQNDYKEQVERQNQLKKRRRKGLYRRLTVFGALVFLTAIVLASSVWSQT
SSLSAKEEKKEQLEKELKSLKTKQTDLKEEISKLKDEDYVTELARRDLFMSGDGEIIFNV
EKKSK
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
ttgaatttttccagggaacgaacgataactgaaatacaaaacgactataaagaacaagta
gaacggcaaaatcagctgaagaaacgaagacgcaaagggctgtacagacggttaactgta
ttcggcgccctagtattcctgacggcaattgtgctggcaagctctgtatggtcccaaaca
tcttcccttagtgcaaaagaagaaaagaaagaacagcttgaaaaagaactgaaaagttta
aagacaaaacaaacggatttaaaagaagaaatatccaaattgaaggatgaggattacgtc
acagagcttgccagaagggacttattcatgtctggagacggagaaattatcttcaatgtg
gagaagaagagcaagtag

DBGET integrated database retrieval system