KEGG   Bacillus subtilis subsp. subtilis 168: BSU00630
Entry
BSU00630          CDS       T00010                                 

Symbol
yabR
Name
(RefSeq) hypothetical protein
  KO
K07571  S1 RNA binding domain protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99974 Translation
    BSU00630 (yabR)
SSDB
Motif
Pfam: S1 S1_2 FH2 CsrA DUF5666
Other DBs
NCBI-GeneID: 936574
NCBI-ProteinID: NP_387944
Pasteur: BG10126
BSORF: BG10126
UniProt: P37560 A0A6M4JEL6
Position
69626..70012
AA seq 128 aa
MSIEVGSKLQGKITGITNFGAFVELPGGSTGLVHISEVADNYVKDINDHLKVGDQVEVKV
INVEKDGKIGLSIKKAKDRPQARPRNDFRPKESFEQKMNKFLKDSEDRLSSLKRNTESKR
GGRGARRG
NT seq 387 nt   +upstreamnt  +downstreamnt
atgtcgattgaagttggcagcaagttgcaagggaaaattacaggtattacaaattttgga
gcatttgttgaattgcctggaggctcaaccggtctcgttcacattagtgaggtagctgat
aattatgtcaaagacattaacgaccacttaaaagtcggcgaccaagttgaagtgaaagtc
atcaacgttgaaaaagacgggaaaattggtttatctattaaaaaagctaaagaccgtccg
caagccagacctagaaatgatttccgtccgaaagaatcttttgaacagaaaatgaataag
tttttaaaagacagcgaagatcgcttgtcatctttaaaacgcaatacggaatcaaaacgt
ggagggcgcggagcaagaagaggataa

DBGET integrated database retrieval system