KEGG   Bacillus subtilis subsp. subtilis 168: BSU00630Help
Entry
BSU00630          CDS       T00010                                 

Gene name
yabR
Definition
(RefSeq) hypothetical protein
  KO
K07571  S1 RNA binding domain protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99974 Translation
    BSU00630 (yabR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S1 S1_2 FH2 CsrA
Motif
Other DBs
NCBI-GeneID: 936574
NCBI-ProteinID: NP_387944
Pasteur: BG10126
BSORF: BG10126
UniProt: P37560
Position
69626..70012
Genome map
AA seq 128 aa AA seqDB search
MSIEVGSKLQGKITGITNFGAFVELPGGSTGLVHISEVADNYVKDINDHLKVGDQVEVKV
INVEKDGKIGLSIKKAKDRPQARPRNDFRPKESFEQKMNKFLKDSEDRLSSLKRNTESKR
GGRGARRG
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattgaagttggcagcaagttgcaagggaaaattacaggtattacaaattttgga
gcatttgttgaattgcctggaggctcaaccggtctcgttcacattagtgaggtagctgat
aattatgtcaaagacattaacgaccacttaaaagtcggcgaccaagttgaagtgaaagtc
atcaacgttgaaaaagacgggaaaattggtttatctattaaaaaagctaaagaccgtccg
caagccagacctagaaatgatttccgtccgaaagaatcttttgaacagaaaatgaataag
tttttaaaagacagcgaagatcgcttgtcatctttaaaacgcaatacggaatcaaaacgt
ggagggcgcggagcaagaagaggataa

DBGET integrated database retrieval system