KEGG   Bacillus subtilis subsp. subtilis 168: BSU00640Help
Entry
BSU00640          CDS       T00010                                 

Gene name
spoIIE
Definition
(RefSeq) stage II sporulation protein E
  KO
K06382  stage II sporulation protein E [EC:3.1.3.16]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU00640 (spoIIE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     BSU00640 (spoIIE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoIIE Kp4 DUF148
Motif
Other DBs
NCBI-GeneID: 938480
NCBI-ProteinID: NP_387945
Pasteur: BG10127
BSORF: BG10127
UniProt: P37475
Structure
PDB: 

Position
70538..73021
Genome map
AA seq 827 aa AA seqDB search
MEKAERRVNGPMAGQALEKLQSFFNRGTKLVTHHLHSLFFYKGFIYVVIGFLLGRAFILS
EVLPFALPFFGAMLLIRRDKAFYAVLAVLAGALTISPKHSLLILAALLAFFVFSKVAAFI
TDDRVKALPIVVFFSMAAARAGFVYAQNGVFTTYDYVMAIVEAGLSFILTLIFLQSLPIF
TVKKVKQSLKIEEIICFMILIASVLTGLAGLSYQGMQAEHILARYVVLSFSFIGGASIGC
TVGVVTGLILGLANIGNLYQMSLLAFSGLLGGLLKEGKKAGAAIGLIVGSLLISLYGEGS
AGLMTTLYESLIAVCLFLLTPQSITRKVARYIPGTVEHLQEQQQYARKIRDVTAQKVDQF
SNVFHALSESFATFYQASDEQTDDSEVDLFLSKITEHSCQTCYKKNRCWVQNFDKTYDLM
KQVMLETEEKEYASNRRLKKEFQQYCSKSKQVEELIEDELAHHHAHLTLKKKVQDSRRLV
AEQLLGVSEVMADFSREIKREREQHFLQEEQIIEALQHFGIEIQHVEIYSLEQGNIDIEM
TIPFSGHGESEKIIAPMLSDILEEQILVKAEQHSPHPNGYSHVAFGSTKSYRVSTGAAHA
AKGGGLVSGDSYSMMELGARKYAAAISDGMGNGARAHFESNETIKLLEKILESGIDEKIA
IKTINSILSLRTTDEIYSTLDLSIIDLQDASCKFLKVGSTPSFIKRGDQVMKVQASNLPI
GIINEFDVEVVSEQLKAGDLLIMMSDGIFEGPKHVENHDLWMKRKMKGLKTNDPQEIADL
LMEEVIRTRSGQIEDDMTVVVVRIDHNTPKWASIPVPAIFQNKQEIS
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagcagaaagaagagtgaacgggccaatggcgggacaagctttggaaaaactc
caatcgttttttaacaggggcacgaagctggtgactcatcatttgcattcactgtttttc
tataaaggattcatttatgttgtcatcggatttttgcttggacgggctttcatattatcc
gaggtgcttcctttcgcacttcctttctttggagcgatgcttcttatcagaagagacaaa
gcgttttatgcggttttggctgtgcttgcaggtgcgctgaccatatctccaaagcactca
ttgctcatactggcggcattgctggcattcttcgtattttctaaagtggctgccttcatt
accgacgatcgtgttaaagcgctcccgattgtcgtgttcttctccatggctgcagcaaga
gccgggtttgtttatgcccaaaatggcgtatttacaacctatgattatgtaatggctatc
gttgaggctggactatcgtttatcttaacactgattttccttcagagccttccgattttt
actgtgaaaaaagtgaaacaatcattaaaaatagaggaaatcatttgctttatgattctt
attgcctctgttttaacggggctggctggcttgtcctaccaagggatgcaggcagaacat
atattggctcgttatgttgtgttgagtttttcctttattggcggagcaagcatcggctgt
acggttggggttgtgaccggcctgattcttggcttggcgaatatcggaaacctatatcaa
atgagtctgcttgctttttccggtttattgggcggtttgctgaaggaagggaaaaaagcg
ggtgcagcaattggtttgatcgttggatcacttcttatatctttatatggtgaaggctct
gccggtctgatgacaacgctctatgagtcattaatcgcagtctgcctgtttttgctcaca
cctcaatctattacgaggaaagtggcgagatatattccgggaactgtcgagcatcttcaa
gagcaacagcaatacgctagaaaaatccgtgatgtcactgctcagaaggtagaccaattc
tccaatgtatttcacgcgctgtctgaaagctttgcaaccttttatcaagcatcagacgaa
cagacagatgacagcgaagttgatctgttcttaagcaaaatcacggagcattcctgccag
acgtgctacaagaaaaacaggtgctgggtacagaactttgataaaacatatgacttaatg
aaacaagttatgcttgaaacagaggaaaaagaatatgcatcaaaccgaaggctgaaaaaa
gagtttcaacagtattgttctaaatccaagcaggttgaagagctgattgaggatgagctc
gcacatcatcatgcccatttgacactcaagaaaaaagtccaagacagcaggcgccttgtt
gctgaacagcttttaggcgtttctgaggttatggccgacttttctcgggaaataaaaaga
gagcgagaacaacactttctgcaggaagagcaaatcatagaagcgcttcagcatttcgga
attgagattcagcatgtcgagatctatagtcttgaacaaggaaatatcgatattgaaatg
accattccgttcagcggacatggagaaagtgaaaaaatcattgctcctatgctttctgac
attctggaggaacaaattcttgtgaaagccgaacagcactctccgcatccgaatggatac
agccatgtcgcctttggatcaacaaaatcatacagggtgtccacgggagctgctcacgct
gcgaagggcggcggccttgtctccggtgacagctacagcatgatggagcttggagccaga
aaatatgctgcagcaatcagtgacggaatgggcaatggcgcaagagcgcactttgaaagc
aatgaaacgatcaagcttcttgaaaaaatccttgaatcgggcattgatgaaaaaatagca
attaaaacgatcaacagcatactgtctctaaggacaactgacgaaatatattccacgctt
gacctatctattatcgatcttcaagatgccagctgtaaatttttgaaggttggatcgacg
cccagctttatcaaacggggtgaccaggtcatgaaagttcaagcgagcaatctgccaatc
ggtattattaatgaattcgatgtggaggttgtgagtgaacagctgaaagcgggtgacctc
ttaattatgatgagtgatggcatttttgaggggcctaagcatgtggaaaatcacgactta
tggatgaagcgtaaaatgaaagggttgaaaacaaatgacccgcaggagattgccgatttg
cttatggaagaagtcatccgcacaagatccggccaaattgaggacgatatgactgttgtt
gtcgtccggattgatcacaatacaccgaagtgggcatccattcctgttccggcaatcttt
caaaacaaacaagaaatttcataa

DBGET integrated database retrieval system