KEGG   Bacillus subtilis subsp. subtilis 168: BSU00650Help
Entry
BSU00650          CDS       T00010                                 

Gene name
yabS
Definition
(RefSeq) hypothetical protein
  KO
K07114  Ca-activated chloride channel homolog
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU00650 (yabS)
Transporters [BR:bsu02000]
 Other Transporters
  Pores ion channels [TC:1]
   BSU00650 (yabS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA VWA_2 YjeF_N DUF1194
Motif
Other DBs
NCBI-GeneID: 936965
NCBI-ProteinID: NP_387946
Pasteur: BG10128
BSORF: BG10128
UniProt: P37561
Position
73106..73843
Genome map
AA seq 245 aa AA seqDB search
MNNGHLNQILLITDGCSNHGEDPLAMAAFAKEQGITVNVIGIMEENQIDPEAMKEVEGIA
LAGGGVHQVVYASQLSQTVQMVTKKAMTQTLQGVVNQELKQILGKNVEMEELSPEKRGEV
MEVVDELGETVHLQVLVLVDTSASMAPKLPTVKEALIDLSVSLNSRIGNNEFAMCIFPGK
KQEVELVLNWTPKLQSLSTLFAKLSTGGITPTGPAIREATLQFEKIRSRRGMLADDERRF
DEFGM
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaacggacatttaaatcaaattttgctgataacggatggctgctcaaaccatggg
gaagacccgcttgcaatggctgcttttgctaaagagcaggggattacggtaaatgtcatt
ggtataatggaagaaaatcaaattgaccctgaggcaatgaaggaagtcgaagggattgca
cttgccggaggaggcgtgcaccaagtcgtttatgcatctcagctttcacaaactgttcaa
atggtaacaaagaaagcgatgacgcaaaccttacaaggtgtagtcaatcaagaactgaaa
cagattctcggaaagaatgtggaaatggaagagctttctccggaaaaacgcggcgaagtc
atggaagtggtagacgagcttggagaaacggtgcatcttcaggttttggttcttgttgat
acaagtgcaagtatggcgccaaagcttccaacagtaaaagaggcgctgattgatttgtct
gtaagcctcaattcccgaattgggaataacgaatttgcgatgtgtatatttcccgggaaa
aaacaagaggtcgagcttgtgctgaactggacaccgaagctgcaatctctttccacactc
tttgcaaagctttcgacaggcggcatcacgccgacaggtccggcgattcgtgaagcgaca
ctgcagtttgaaaaaatacgctcaagaaggggcatgctggcagatgatgaacgacgcttt
gacgagtttggcatgtag

DBGET integrated database retrieval system