KEGG   Bacillus subtilis subsp. subtilis 168: BSU00660Help
Entry
BSU00660          CDS       T00010                                 

Gene name
yabT
Definition
(RefSeq) serine/threonine protein kinase
  KO
K08884  serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU00660 (yabT)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BSU00660 (yabT)
Protein kinases [BR:bsu01001]
 Serine/threonine kinases: Other
  Bacterial family
   BSU00660 (yabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase APH Pkinase_Tyr TRIQK
Motif
Other DBs
NCBI-GeneID: 936964
NCBI-ProteinID: NP_387947
Pasteur: BG10129
BSORF: BG10129
UniProt: P37562
Structure
PDB: 

Position
73809..74825
Genome map
AA seq 338 aa AA seqDB search
MMNDALTSLACSLKPGTTIKGKWNGNTYTLRKQLGKGANGIVYLAETSDGHVALKVSDDS
LSITSEVNVLKSFSKAQSVTMGPSFFDTDDAYIPSANTKVSFYAMEYIKGPLLLKYVSDK
GAEWIPVLMIQLLSSLSVLHQQGWIFGDLKPDNLIVTGPPARIRCIDVGGTTKEGRAIKE
YTEFYDRGYWGYGTRKAEPSYDLFAVAMIMINSVHKKEFKKTNQPKEQLRSLIEGNPLLQ
KYKKALFSALNGDYQSADEMKKDMLDAGQKAAQRKQPIKASPQPATRQRQQKPRQGKITK
TRYTPKQKPAKSGGLFETTLIVISVLALYFAYIIFFLI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacgacgctttgacgagtttggcatgtagcctcaagccgggtacgacaatcaaa
ggcaagtggaatggaaacacttatacattgcgtaaacagcttggtaaaggggccaatgga
attgtgtatttggcagaaacatcagatggacatgttgccttaaaggtgagtgatgacagc
ctgtctattacttctgaagtgaatgtcttgaaatctttctcaaaggcccagtccgttacg
atggggccttctttttttgatacggatgatgcctatattcccagtgccaatacgaaagtt
tcattttatgcaatggaatacataaaagggccgctgcttttgaagtatgtcagtgataaa
ggagcagagtggataccggtattaatgattcagctgttatccagcttatcggtgcttcac
cagcaaggatggatattcggcgatcttaaacctgataatctgatcgtaactggtccgccc
gcaaggatccgctgcattgatgtgggcggcacgacaaaggaaggccgggcgataaaagag
tatacggagttttatgacagaggctattgggggtatggaacaagaaaggcagagccatcc
tatgatctgttcgcagttgccatgattatgatcaacagtgtgcataaaaaagaatttaag
aaaacgaaccagcccaaagaacagcttaggtctctcatcgaaggaaacccgctgcttcaa
aagtataaaaaagcgcttttttcagccttgaacggagattatcaatccgcagatgaaatg
aaaaaggatatgctagacgcggggcaaaaagcagcacaaagaaaacagcctataaaagca
tcaccgcagcctgccacacgacaaagacagcaaaaaccgcgccaaggaaaaataacgaag
acgcgatataccccaaaacagaaaccggctaagtcgggggggttatttgaaacaacgctt
atcgtgatcagtgttttagcgctttatttcgcctatattatctttttcttaatctga

DBGET integrated database retrieval system