KEGG   Bacillus subtilis subsp. subtilis 168: BSU00670Help
Entry
BSU00670          CDS       T00010                                 

Gene name
tilS
Definition
(RefSeq) tRNA(ile)-lysidine synthase
  KO
K04075  tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU00670 (tilS)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     BSU00670 (tilS)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BSU00670 (tilS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_3 TilS_C TilS NAD_synthase
Motif
Other DBs
NCBI-GeneID: 936922
NCBI-ProteinID: NP_387948
Pasteur: BG10130
BSORF: BG10130
UniProt: P37563
Position
74929..76347
Genome map
AA seq 472 aa AA seqDB search
MKSVKDFLNKHNLTLKGATIIVGVSGGPDSMALLHALHTLCGRSANVIAAHVDHRFRGAE
SEEDMRFVQAYCKAEQLVCETAQINVTAYAQEKGLNKQAAARDCRYQFFEEIMSKHQADY
LALAHHGDDQVETMLMKLAKGTLGTGLAGMQPVRRFGTGRIIRPFLTITKEEILHYCHEN
GLSYRTDESNAKDDYTRNRFRKTVLPFLKQESPDVHKRFQKVSEALTEDEQFLQSLTKDE
MNKVITSQSNTSVEINSSQLLALPMPLQRRGVQLILNYLYENVPSSFSAHHIQQFLDWAE
NGGPSGVLDFPKGLKVVKSYQTCLFTFEQWQCKNVPFEYQISGAADETAVLPNGYLIEAR
HYADSPEEHGNAVFITSEKKVRFPLTIRTRKAGDRIKLKGMNGSKKVKDIFIDKKLPLQE
RDNWPIVTDASGEIIWIPGLKKSIFEDLVIPNSDRIVLQYRQHEKCRGQAKS
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagtgtcaaagattttttaaacaaacacaatcttacgttaaaaggggcgacaatc
attgtaggcgtttccggcggtccggactcaatggctcttcttcacgcgttgcatacgtta
tgcggccgttcagcgaatgttattgcagctcacgttgaccatcggttcagaggtgcggaa
tccgaggaggacatgcgttttgtccaagcttattgtaaagctgaacagctcgtgtgcgaa
acggctcaaatcaatgtaaccgcatatgcacaggaaaaaggactcaataagcaggctgca
gcacgcgattgccgctaccagttttttgaggaaatcatgtcgaagcaccaagcggactat
ctggctcttgcgcatcatggtgatgaccaggttgaaacaatgcttatgaaactggctaag
ggtacgcttggaacgggacttgcgggaatgcagccggttagacgttttgggacagggcgg
atcatcaggccgttcttaaccattacaaaggaagagatccttcactattgccatgaaaac
ggcttgagctaccggacggatgaaagcaacgccaaagatgactacacaagaaacagattc
agaaaaacagtgctcccgtttttgaagcaggaatctccggatgtgcataaaaggtttcag
aaagtgagtgaagcactgacggaagatgagcaattcttacagtcattaacgaaagatgaa
atgaataaagtaatcacaagccagtctaatacatcagttgaaatcaattcctctcaattg
cttgccctcccgatgcctttacaaagaagaggagttcaactaatattaaactatctttat
gaaaacgttccatcatccttttcagcccatcacattcagcagtttctcgattgggcggaa
aatggcggtccttcaggagtactggactttccgaaagggctgaaggtggtcaaatcatat
cagacatgtttgtttacatttgaacaatggcagtgcaaaaatgttccctttgaataccaa
attagcggagctgctgatgaaacggcagtgctccctaatggatatctgatagaggcaagg
cattatgcggactcgcctgaagaacatgggaatgctgtttttatcacaagtgaaaaaaag
gtgcgatttcccttaacaatccggacgagaaaagctggagaccggatcaaactaaaaggg
atgaacggctcaaaaaaggtaaaggatatatttattgataagaaattgcctctccaagaa
agagacaactggccgattgtgacggacgcaagcggtgaaattatctggatacctggcttg
aaaaaatcaatttttgaagatcttgtgattccaaacagcgaccgcattgtattacaatat
agacagcatgaaaagtgtagggggcaagcaaaatcatga

DBGET integrated database retrieval system