KEGG   Bacillus subtilis subsp. subtilis 168: BSU00680
Entry
BSU00680          CDS       T00010                                 

Symbol
hprT
Name
(RefSeq) hypoxanthine-guanine phosphoribosyltransferase
  KO
K00760  hypoxanthine phosphoribosyltransferase [EC:2.4.2.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU00680 (hprT)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.8  hypoxanthine phosphoribosyltransferase
     BSU00680 (hprT)
SSDB
Motif
Pfam: Pribosyltran Pribosyltran_N UPRTase
Other DBs
NCBI-GeneID: 936945
NCBI-ProteinID: NP_387949
Pasteur: BG10131
BSORF: BG10131
UniProt: P37472 A0A6M3Z6H8
Position
76344..76886
AA seq 180 aa
MMKHDIEKVLISEEEIQKKVKELGAELTSEYQDTFPLAIGVLKGALPFMADLIKHIDTYL
EMDFMDVSSYGNSTVSSGEVKIIKDLDTSVEGRDILIIEDIIDSGLTLSYLVELFRYRKA
KSIKIVTLLDKPSGRKADIKADFVGFEVPDAFVVGYGLDYAERYRNLPYIGVLKPAVYES
NT seq 543 nt   +upstreamnt  +downstreamnt
atgatgaaacatgatatcgagaaagtactgatctcagaggaagagatacaaaagaaagta
aaagagttaggtgcagaattaacgagcgagtatcaagatacatttccgttggcaatcggt
gtgttaaaaggagcacttccttttatggcggatcttatcaagcatattgatacatatttg
gaaatggatttcatggatgtatcaagctacggaaattctacggtttcttctggagaagta
aaaatcattaaagatttggatacatctgtagagggccgggacatcttaattattgaagat
atcatcgacagtgggttaaccttaagttatctcgtagagctcttccgataccgtaaagca
aaatcaattaagattgttacccttttggataaaccgagcggaagaaaagcggacatcaaa
gcagactttgtcggttttgaagttcctgacgcgtttgtagtgggttacggacttgattat
gctgagcgctatcgcaatctgccttatatcggagtgttaaaaccggcagtttatgaaagc
tga

DBGET integrated database retrieval system