KEGG   Bacillus subtilis subsp. subtilis 168: BSU00700Help
Entry
BSU00700          CDS       T00010                                 

Gene name
coaX
Definition
(RefSeq) type III pantothenate kinase
  KO
K03525  type III pantothenate kinase [EC:2.7.1.33]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
Module
bsu_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU00700 (coaX)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     BSU00700 (coaX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pan_kinase
Motif
Other DBs
NCBI-GeneID: 936960
NCBI-ProteinID: NP_387951
Pasteur: BG10133
BSORF: BG10133
UniProt: P37564
Position
79092..79868
Genome map
AA seq 258 aa AA seqDB search
MLLVIDVGNTNTVLGVYHDGKLEYHWRIETSRHKTEDEFGMILRSLFDHSGLMFEQIDGI
IISSVVPPIMFALERMCTKYFHIEPQIVGPGMKTGLNIKYDNPKEVGADRIVNAVAAIHL
YGNPLIVVDFGTATTYCYIDENKQYMGGAIAPGITISTEALYSRAAKLPRIEITRPDNII
GKNTVSAMQSGILFGYVGQVEGIVKRMKWQAKQEPKVIATGGLAPLIANESDCIDIVDPF
LTLKGLELIYERNRVGSV
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgttactggttatcgatgtggggaacaccaatactgtacttggtgtatatcatgatgga
aaattagaatatcactggcgtatagaaacaagcaggcataaaacagaagatgagtttggg
atgattttgcgctccttatttgatcactccgggcttatgtttgaacagatagatggcatt
attatttcgtcagtagtgccgccaatcatgtttgcgttagaaagaatgtgcacaaaatac
tttcatatcgagcctcaaattgttggtccaggtatgaaaaccggtttaaatataaaatat
gacaatccgaaagaagtaggggcagacagaatcgtaaatgctgtcgctgcgatacacttg
tacggcaatccattaattgttgtcgatttcggaaccgccacaacgtactgctatattgat
gaaaacaaacaatacatgggcggggcgattgcccctgggattacaatttcgacagaggcg
ctttactcgcgtgcagcaaagcttcctcgtatcgaaatcacccggcccgacaatattatc
ggaaaaaacactgttagcgcgatgcaatctggaattttatttggctatgtcggccaagtg
gaaggaatcgttaagcgaatgaaatggcaggcaaaacaggaaccaaaggtcattgcgaca
ggaggcctggcgccgctcattgcgaacgaatcagattgtatagacatcgttgatccattc
ttaaccctaaaagggctggaattgatttatgaaagaaaccgcgtaggaagtgtatag

DBGET integrated database retrieval system