KEGG   Bacillus subtilis subsp. subtilis 168: BSU00710Help
Entry
BSU00710          CDS       T00010                                 

Gene name
hslO
Definition
(RefSeq) chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU00710 (hslO)
Chaperones and folding catalysts [BR:bsu03110]
 Heat shock proteins
  HSP33
   BSU00710 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-GeneID: 936762
NCBI-ProteinID: NP_387952
Pasteur: BG10134
BSORF: BG10134
UniProt: P37565
Structure
PDB: 

Position
79880..80755
Genome map
AA seq 291 aa AA seqDB search
MDYLVKALAYDGKVRAYAARTTDMVNEGQRRHGTWPTASAALGRTMTASLMLGAMLKGDD
KLTVKIEGGGPIGAIVADANAKGEVRAYVSNPQVHFDLNEQGKLDVRRAVGTNGTLSVVK
DLGLREFFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFIIQLM
PGTDDETITKIEQRLSQVEPISKLIQKGLTPEEILEEVLGEKPEILETMPVRFHCPCSKE
RFETAILGLGKKEIQDMIEEDGQAEAVCHFCNEKYLFTKEELEGLRDQTTR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggattatttagtaaaagcacttgcgtatgacggaaaagttcgggcttatgcagcgaga
acgactgatatggtaaatgaggggcagagacgccatggtacgtggccgacagcatccgct
gcactaggccgtacaatgacagcttcacttatgctcggcgctatgctgaagggcgatgat
aagctgaccgtgaaaatcgagggcggaggtccgatcggagctattgtagctgatgccaat
gccaaaggagaagtcagagcctatgtctctaacccgcaagttcattttgatttaaatgaa
caaggtaagcttgatgtcagacgtgcggttggaacaaacggaacgttaagtgtcgtaaaa
gatttaggtttgcgcgagttcttcacaggacaagtagaaatcgtttcaggagaattagga
gatgattttacttactatcttgtgtcatctgagcaggttccttcatcagtgggcgtaggt
gtgctcgtaaatcctgacaataccattcttgcggcagggggctttattattcagctgatg
ccgggaacagatgatgaaacaatcacaaaaattgaacagcgtctatctcaagtagagccg
atttctaagctcatccaaaaagggctgacaccagaagaaattttagaagaagtcctaggc
gagaaacctgagattttggaaacgatgcctgtcagattccattgcccttgttcaaaagaa
cggttcgaaacagccattttaggactaggcaaaaaagaaattcaagatatgatagaagaa
gatggacaagccgaagcagtatgccatttttgtaatgaaaagtacttatttacaaaagaa
gagctggaagggcttcgtgaccaaactacccgctaa

DBGET integrated database retrieval system