KEGG   Bacillus subtilis subsp. subtilis 168: BSU00720
Entry
BSU00720          CDS       T00010                                 

Symbol
yacD
Name
(RefSeq) peptidyl-prolyl cis-trans isomerase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Rotamase_2 Rotamase SurA_N_3 Rotamase_3 SurA_N_2 SurA_N PrpR_N CKS
Other DBs
NCBI-GeneID: 936955
NCBI-ProteinID: NP_387953
Pasteur: BG10135
BSORF: BG10135
UniProt: P37566 A0A6M4JE15
Position
80802..81695
AA seq 297 aa
MKSRTIWTIILGALLVCCIAVAYTLTKSQAGASSSGESIATIGGKSVTREEWLKEMEDQY
GKSTLEDMINVRVVEQLAKKNKLKISKSEVDREFLLIKAVNNSFYEDEHTTEKEWKDQIR
YNILLEDLLTRDIDISNKELESFYNKNKELYQFDDSYRIRHIVVKDEEEAREVLKELKGG
SSFEAVAAERSTDRYTSPYGGDLGFVTEASDNIPSAYIEEAKTLKEDEWSQEPIKVSNGY
AIIQLKEKLKARTFSFDEVKDQIRRQIAMDQLGDKATVKTLWKEADVSWFYGEKSTK
NT seq 894 nt   +upstreamnt  +downstreamnt
ttgaaatcaagaacaatctggaccattattttaggggcgctgttggtttgctgtattgct
gttgcatatacgctgacgaaatcccaagccggcgcatcgtcatccggtgagtctattgcg
actatcggaggcaagagtgtgacaagagaagaatggctgaaagaaatggaagatcagtat
ggtaagtcaacgcttgaagatatgatcaatgtccgagttgttgagcagctggctaaaaag
aacaaacttaaaatatccaaaagcgaagttgatcgtgagtttttgctgattaaagcggtc
aataattccttttacgaagatgaacatacgacggagaaagagtggaaagaccaaattcgt
tataatatcctccttgaggatttgttaacaagggatatcgatatctcaaacaaagaattg
gaatcattctataataaaaataaggaactatatcagtttgatgattcgtatcgaattcgg
cacattgttgtaaaagatgaagaagaagcaagagaagtcctgaaagaactgaaaggcgga
tcaagctttgaagctgtcgctgccgaaagatctacagacagatatacatcaccatacggc
ggagatttaggttttgtcacagaggcatcagacaacattccatcagcatacattgaagag
gcgaaaacactcaaagaggatgaatggtctcaggaaccaataaaggtcagcaacggatat
gccattatccagctgaaagaaaaactaaaggcaagaacgttctcatttgatgaagtaaag
gaccagatcagacggcaaatcgcaatggatcagctaggcgataaagcgacagttaagaca
ctttggaaagaagccgatgtatcttggttttatggggaaaaaagtactaagtga

DBGET integrated database retrieval system