KEGG   Bacillus subtilis subsp. subtilis 168: BSU00730Help
Entry
BSU00730          CDS       T00010                                 

Gene name
cysK
Definition
(RefSeq) cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu00920  Sulfur metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSU00730 (cysK)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU00730 (cysK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     BSU00730 (cysK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP ADH_zinc_N
Motif
Other DBs
NCBI-GeneID: 936636
NCBI-ProteinID: NP_387954
Pasteur: BG10136
BSORF: BG10136
UniProt: P37887
Position
81771..82697
Genome map
AA seq 308 aa AA seqDB search
MVRVANSITELIGNTPIVKLNRLADENSADVYLKLEYMNPGSSVKDRIGLAMIEAAEKEG
KLKAGNTIIEPTSGNTGIGLAMVAAAKGLKAILVMPDTMSMERRNLLRAYGAELVLTPGA
EGMKGAIKKAEELAEKHGYFVPQQFNNPSNPEIHRQTTGKEIVEQFGDDQLDAFVAGIGT
GGTITGAGEVLKEAYPSIKIYAVEPSDSPVLSGGKPGPHKIQGIGAGFVPDILNTEVYDE
IFPVKNEEAFEYARRAAREEGILGGISSGAAIYAALQVAKKLGKGKKVLAIIPSNGERYL
STPLYQFD
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtgtagcaaactccattactgaattaattgggaatacgccaatcgttaaatta
aatcgccttgcagatgaaaacagtgcggatgtatatctaaaacttgaatacatgaaccct
ggaagcagtgtaaaagaccgtatcggtttagctatgattgaagcggctgaaaaagaagga
aaattaaaagccggtaatacaatcattgaaccgacaagcggaaatactggaatcgggctt
gcaatggttgctgctgctaaaggattaaaagccattttggttatgcctgatacaatgagc
atggagcgccgcaaccttcttcgcgcatatggtgctgagcttgtgctgactcctggtgcg
gaaggcatgaaaggtgctattaagaaagctgaagagcttgctgaaaagcacggatacttt
gtgccgcagcagtttaacaacccttctaaccccgaaattcaccgccaaacaacgggtaaa
gaaatcgttgagcaattcggtgatgatcagcttgacgcatttgtagccggaatcggaacg
ggcggaacgattacgggagcgggcgaagtgctgaaggaagcatacccttccatcaagatt
tatgctgttgaaccgtcagattccccagtgctttcaggaggaaaaccaggcccccacaaa
attcagggaatcggagcaggattcgtgccggacatcttaaacactgaagtatatgatgaa
atcttccctgtgaagaatgaagaagcattcgaatatgcccgcagagctgcacgtgaagaa
ggaattctcggaggcatctcatcaggtgcggcaatttatgctgctcttcaagtagcaaaa
aaactcggaaaaggcaaaaaagtattggccatcattccaagtaacggcgaacgttatcta
agcacgccgctgtaccaattcgattaa

DBGET integrated database retrieval system