KEGG   Bacillus subtilis subsp. subtilis 168: BSU00740Help
Entry
BSU00740          CDS       T00010                                 

Gene name
pabB
Definition
(RefSeq) para-aminobenzoate synthase component 1
  KO
K01665  para-aminobenzoate synthetase component I [EC:2.6.1.85]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU00740 (pabB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.85  aminodeoxychorismate synthase
     BSU00740 (pabB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-GeneID: 936926
NCBI-ProteinID: NP_387955
Pasteur: BG10137
BSORF: BG10137
UniProt: P28820
Position
82864..84276
Genome map
AA seq 470 aa AA seqDB search
MAQRRPAGKKIPFQKDSFLQQFEKLAQSRKHHVLLESARGGRYSIAGLDPIATVKGKDGI
TTIKHGDEMLFKEGDPLRAFHSWFKTLETETNHEFPDFQGGAIGFLSYDYARYIENFKML
SLDDLETPDIYFLVFDDIAVYDHQEESLWLITHVNGSDQETADVKLSELEQMWLTELPAV
TSREMKPETAGSFAAPFTEDGFSQAVEKIKQYIASGDVFQVNLSIRQSQSLSVHPYQIYK
TLREVNPSPYMAYLETPDFQIICGSPELLVSKKGKLLETRPIAGTRSRGKTNEEDEALAN
ELIHNEKERAEHVMLVDLERNDLGRVSRYGSVRVNEFMAIEKYSHVMHIVSNVQGELQDG
YDAVDIIHAVFPGGTITGAPKVRTMEIIEELEPTRRGLYTGSIGWFGYNHDLQFNIVIRT
IYATGGQAFMQSGAGVVIDSVPKHEYKESFKKAFAMQRALELSEEETKIR
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacgcagaccggcaggcaaaaaaataccttttcaaaaagactcattcttacaa
caatttgagaaacttgcgcaatcccggaaacatcatgtacttctcgaaagtgcaagaggc
ggcagatatagtatagccggtcttgatccaattgcgactgtgaaaggaaaagacggaata
actacaattaagcatggtgatgagatgctgtttaaagaaggtgatccattacgggccttc
cacagctggtttaaaacactggaaacagaaacgaatcatgagttccctgactttcaaggc
ggggcaatcgggtttctcagctatgattacgcacggtacattgaaaattttaaaatgctc
tcattagatgatttagaaacaccagatatttattttcttgtttttgatgatatagcagtt
tatgaccatcaagaagagtctctatggctgattactcatgttaatggttctgatcaggaa
acagcggatgtgaagctatctgagttagagcagatgtggttgactgagcttcccgctgtc
acttcgcgagagatgaagcctgaaacagctggttctttcgcggcgccatttaccgaggat
gggttctcacaagctgtagagaaaatcaaacaatacattgccagcggagatgtgtttcaa
gtcaatctatcaataaggcagtcacagtcactgtctgtccacccatatcaaatttacaaa
accttgagagaagtaaatccttctccttatatggcgtatttagaaacacctgatttccaa
atcatttgcggatcgcctgaactgcttgtcagcaaaaagggcaagctattagagacgaga
ccgattgcgggcacccgttccagagggaaaacaaatgaagaagacgaggcgcttgcaaac
gaattgatacacaatgaaaaagaacgcgcggaacatgtcatgctggttgatcttgagcga
aatgatctgggaagagtatcacgttacgggtctgtgcgcgtaaatgaattcatggcaatt
gaaaaatactcgcatgtgatgcacattgtgtctaatgtccaaggtgaactgcaggatggg
tatgatgctgtagatattattcatgctgtgtttcccggaggaaccattactggtgcaccg
aaagtaagaacgatggaaattatagaagaacttgagccgacacgccgagggctttatact
ggatctataggatggtttggatataatcacgatctgcagtttaatatcgtcattcgaacc
atttatgcaaccggagggcaggcatttatgcagtccggtgcaggagttgtgattgattct
gttccgaagcacgaatacaaggaatcattcaaaaaagcttttgcgatgcaaagagcatta
gagctgagcgaagaagagacaaaaattagatga

DBGET integrated database retrieval system