KEGG   Bacillus subtilis subsp. subtilis 168: BSU00750Help
Entry
BSU00750          CDS       T00010                                 

Gene name
pabA
Definition
(RefSeq) para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II
  KO
K01664  para-aminobenzoate synthetase component II [EC:2.6.1.85]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU00750 (pabA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.85  aminodeoxychorismate synthase
     BSU00750 (pabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-GeneID: 936441
NCBI-ProteinID: NP_387956
Pasteur: BG10138
BSORF: BG10138
UniProt: P28819
Position
84290..84874
Genome map
AA seq 194 aa AA seqDB search
MILMIDNYDSFTYNLVQYLGELGEELVVKRNDSITIDEIEELSPDFLMISPGPCSPDEAG
ISLEAIKHFAGKIPIFGVCLGHQSIAQVFGGDVVRAERLMHGKTSDIEHDGKTIFEGLKN
PLVATRYHSLIVKPETLPSCFTVTAQTKEGEIMAIRHNDLPIEGVQFHPESIMTSFGKEM
LRNFIETYRKEVIA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgattttaatgattgataactacgattcattcacgtacaacttggtacagtatttgggc
gagcttggggaagagctggttgtgaaacgcaatgacagcatcacaatcgatgaaattgaa
gaactgtctccggactttctgatgatatctcccggaccgtgcagccctgatgaggcggga
atcagcctcgaagcaattaaacatttcgcagggaaaattcctattttcggtgtatgtctc
ggacatcagtccatcgcacaagtgttcggtggtgatgttgttagggcagaacggcttatg
cacgggaaaacctcggatatcgagcatgacggcaaaaccatttttgaagggttgaaaaat
ccccttgttgcgacgcgataccactcgctgatcgtaaaacctgagacgctgccaagctgt
tttacagtaacagcacaaacgaaagaaggagaaatcatggctattcgccacaatgacctc
ccgatagagggtgtgcaatttcacccagagtctattatgacctcctttgggaaagaaatg
ctcagaaattttattgagacatatcgcaaggaagttattgcgtga

DBGET integrated database retrieval system