KEGG   Bacillus subtilis subsp. subtilis 168: BSU00760Help
Entry
BSU00760          CDS       T00010                                 

Gene name
pabC
Definition
(RefSeq) 4-amino-4-deoxychorismate lyase
  KO
K02619  4-amino-4-deoxychorismate lyase [EC:4.1.3.38]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU00760 (pabC)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.38  aminodeoxychorismate lyase
     BSU00760 (pabC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-GeneID: 936944
NCBI-ProteinID: NP_387957
Pasteur: BG10139
BSORF: BG10139
UniProt: P28821
Position
84874..85755
Genome map
AA seq 293 aa AA seqDB search
MIYVNGRYMEEKDAVLSPFDHGFLYGIGVFETFRLYEGCPFLLDWHIERLERALKDLQIE
YTVSKHEILEMLDKLLKLNDIKDGNARVRLNISAGISDKGFVAQTYDKPTVLCFVNQLKP
ESLPLQKEGKVLSIRRNTPEGSFRLKSHHYLNNMYAKREIGNDPRVEGIFLTEDGAVAEG
IISNVFWRKGRCIYTPSLDTGILDGVTRRFIIENAKDIGLELKTGRYELEALLTADEAWM
TNSVLEIIPFTKIEEVNYGSQSGEATSALQLLYKKEIKNMIHEKGGRAWRSTQ
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgtgaacggccggtatatggaggagaaagatgcagttctttctccttttgac
catgggtttttatatgggatcggtgttttcgaaaccttcaggctctacgaaggctgcccg
tttttgcttgattggcatatagagaggcttgaacgcgcgcttaaggatctgcaaatcgaa
tatactgtttcaaagcatgagatccttgagatgctggacaagctgcttaagctaaatgat
atcaaggatggcaatgcccgcgtcagactgaacatatcagcgggaatcagcgataaaggc
tttgtcgcccagacgtacgataagcccaccgttttatgctttgtgaatcagctgaaacca
gaaagtcttcctttgcaaaaagaaggaaaggttttatcgatacggagaaacactccagag
ggatcgttccggttaaaatctcatcattatctaaataatatgtatgcgaaacgggaaatt
ggaaatgatccgcgtgtcgagggaattttcttaacggaggatggagctgttgcagagggt
atcatatctaatgtcttctggagaaaaggtcgctgtatctatacgccatcgcttgatacc
ggtattctggacggcgtcacgagacgttttatcatagaaaatgcaaaggatatcggcctg
gagctcaaaacgggccgatatgagctagaagctctcttgacagctgacgaagcgtggatg
acgaactcggttcttgaaatcatcccgtttactaaaatagaagaagtaaactatggaagc
caaagcggagaagcaacctccgctcttcaattgttatacaaaaaagaaataaagaacatg
attcatgaaaagggaggaagagcatggcgcagcacacaatag

DBGET integrated database retrieval system