KEGG   Bacillus subtilis subsp. subtilis 168: BSU00780Help
Entry
BSU00780          CDS       T00010                                 

Gene name
folB
Definition
(RefSeq) dihydroneopterin aldolase
  KO
K01633  7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00790  Folate biosynthesis
bsu01100  Metabolic pathways
Module
bsu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU00780 (folB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.81  7,8-dihydroneopterin oxygenase
     BSU00780 (folB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     BSU00780 (folB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.8  7,8-dihydroneopterin epimerase
     BSU00780 (folB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FolB
Motif
Other DBs
NCBI-GeneID: 937976
NCBI-ProteinID: NP_387959
Pasteur: BG10141
BSORF: BG10141
UniProt: P28823
Position
86587..86949
Genome map
AA seq 120 aa AA seqDB search
MDKVYVEGMEFYGYHGVFTEENKLGQRFKVDLTAELDLSKAGQTDDLEQTINYAELYHVC
KDIVEGEPVKLVETLAERIAGTVLGKFQPVQQCTVKVIKPDPPIPGHYKSVAIEITRKKS
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggataaagtttatgtagaaggtatggagttttacggatatcacggtgtgttcacagaa
gaaaacaaacttggccagcggtttaaagtcgatttaaccgctgagctggatttaagcaaa
gctggacagacagacgaccttgagcaaacgatcaactatgctgagctctatcacgtatgt
aaagatatcgtggaaggggagcctgtgaaattggtggaaacgctggcggaacgtattgct
ggcactgttctcggaaaatttcagcctgttcagcaatgtacggtgaaagtgattaagcca
gacccgccaattcccggacactataaatcagtagcaattgaaattacgagaaaaaagtca
tga

DBGET integrated database retrieval system