KEGG   Bacillus subtilis subsp. subtilis 168: BSU00800Help
Entry
BSU00800          CDS       T00010                                 

Gene name
yazB
Definition
(RefSeq) XRE family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_31 HTH_19 HTH_25 HTH_23 HTH_37 GP3_package HTH_26 WYL_3
Motif
Other DBs
NCBI-GeneID: 936295
NCBI-ProteinID: NP_387961
Pasteur: BG12701
BSORF: BG12701
UniProt: O31417
Position
87401..87610
Genome map
AA seq 69 aa AA seqDB search
MEAEIWGRRIRAFRKLKGYTQEGFAKALGISVSILGEIERGNRLPSAAIIQDAADVLNIS
ADELAPPEK
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagaaatctggggtagacgaattcgtgcattcagaaagctgaaaggttatact
caagaaggatttgcaaaagcattaggtatatcagtttctattctcggcgaaattgaacgc
ggaaaccgattgccgtctgctgccatcattcaagatgcagcagatgttttaaatataagt
gcggacgaattggcgccgccagaaaaatag

DBGET integrated database retrieval system