KEGG   Bacillus subtilis subsp. subtilis 168: BSU00820Help
Entry
BSU00820          CDS       T00010                                 

Gene name
lysS
Definition
(RefSeq) lysine--tRNA ligase
  KO
K04567  lysyl-tRNA synthetase, class II [EC:6.1.1.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
Module
bsu_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU00820 (lysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU00820 (lysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU00820 (lysS)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.6  lysine---tRNA ligase
     BSU00820 (lysS)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   BSU00820 (lysS)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BSU00820 (lysS)
 Prokaryotic Type
   Other AARSs
    BSU00820 (lysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d Sortase
Motif
Other DBs
NCBI-GeneID: 936911
NCBI-ProteinID: NP_387963
Pasteur: BG10144
BSORF: BG10144
UniProt: P37477
Position
88727..90226
Genome map
AA seq 499 aa AA seqDB search
MSQEEHNHEELNDQLQVRRDKMNQLRDNGIDPFGARFERTHQSQEVISAYQDLTKEELEE
KAIEVTIAGRMMTKRGKGKAGFAHLQDLEGQIQIYVRKDSVGDDQYEIFKSSDLGDLIGV
TGKVFKTNVGELSVKATSFELLTKALRPLPDKYHGLKDVEQRYRQRYLDLIVNPDSKHTF
ITRSKIIQAMRRYLDDHGYLEVETPTMHSIPGGASARPFITHHNALDIPLYMRIAIELHL
KRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMSLTENLVAHIAQE
VLGTTTIQYGEEQIDLKPEWKRIHMVDAVKEATGVDFWEEVTVEQAREYAKEHEVEIKDS
MTVGHIINEFFEQKIEETLIQPTFIYGHPVEISPLAKKNPEDPRFTDRFELFIVGREHAN
AFTELNDPIDQRERFEAQLKEREAGNDEAHLMDEDFVEALEYGMPPTGGLGIGIDRLVML
LTNAPSIRDVLLFPQMRQR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagaagagcataaccatgaagaattgaatgatcagctgcaagtcagacgcgat
aaaatgaatcagctgagagataacggcatcgatccattcggcgcacgttttgaaagaact
catcagtctcaagaagttatttcggcatatcaagatctaaccaaagaagagttagaagaa
aaagcgattgaagttacaatcgcaggccgcatgatgacaaaacgcggcaaaggaaaagcc
ggctttgcccatcttcaggatttagaaggccaaatccaaatctacgtaagaaaagacagt
gtcggtgacgaccaatatgaaatcttcaagtcttctgacctcggtgatcttatcggcgta
accggaaaagtcttcaaaacaaatgtaggcgaattgtctgttaaagcaacttcctttgaa
ttgctgacaaaagcgcttcgtccgcttcctgacaaataccatggtttaaaagacgttgag
cagcgctaccgtcagcgctatctggatcttatcgtaaacccagacagcaaacatacgttc
attacacgaagcaagatcattcaagctatgagaaggtaccttgatgatcatggatactta
gaagtagaaacacctacaatgcacagcattcctgggggagcttctgcacgtccgtttatc
actcaccacaacgcgttagacattccactctatatgcgtattgctatcgaactgcaccta
aaacgtctaattgtcggcggtttagaaaaagtatatgaaatcggccgtgttttccgtaac
gaaggtgtctctacacgccataaccctgaatttacaatgattgagttatatgaagcatat
gcggactataaagatatcatgagcttaactgaaaaccttgtcgctcatatcgcccaagaa
gtgcttggcacaactacgattcaatacggggaagagcaaatcgaccttaaaccggagtgg
aaaagaatccatatggttgacgcagtcaaagaagcgaccggcgttgatttctgggaagag
gttactgttgagcaggcgcgtgaatatgcaaaagaacatgaagtagaaattaaagactct
atgacagtaggccatatcatcaacgaattcttcgaacaaaaaattgaagaaacgcttatt
cagccaacgtttatttacgggcatcctgtagaaatttctcctcttgctaagaaaaaccct
gaggacccgcgttttacagaccgttttgagctgtttatcgttggccgtgaacatgccaac
gcgtttacagagctgaatgatcctattgatcaaagagaacgctttgaagcgcaattaaaa
gagcgtgaagccggtaatgatgaagctcatttaatggatgaagactttgttgaagctctg
gaatacggtatgccgccaacaggaggtttaggcatcggtatcgaccgtctggttatgctg
ctgacgaatgccccttctattcgcgatgtgctgttattcccgcaaatgagacaacgctaa

DBGET integrated database retrieval system